Piperic
linking domains
‹ Profile Export Lead ListFree Data

Linking domains to snacksafely.com

64 linking domains point to snacksafely.com from their homepage — each shown with its tech stack, contacts and AI policy.

Homepage outbound links from our live crawl (not a full backlink index).

Export 64 leads → in CSV · JSON · XLSX · browse free
Linking domainStatusTitleCountry/LangCategoryAI filesContactAI-protection
alamodeshoppe.com 200 Buy Allergy Free Ice Cream | Nut-free, Egg-Free, and Sesame-Free Ice Cream Online - A La Mode en Desserts and BakingWordPressWooCommerce robots emailphone none
allendalepto.com 200 Allendale Elementary PTO - Home Page United States~ en Education phone none
allerglow.com 200 Allergy-Friendly Bath and Body Skincare | AllerGlow en Skin CareShopify robotsllms email none
allergyandglutenfreecookie.com 200 Allergy Friendly & Gluten Free Cookies at The Dessert Board Company – Allergy Friendly & Gluten Free Cookies at The Dessert Board Company en Desserts and BakingShopify robotsllms none
allergyfreemarketplace.com 200 Allergy-Friendly Snacks - So Good, So Safely Delicious – Safely Delicious® en Shopify none
allergyfreemarketplace.net 200 Allergy-Friendly Snacks - So Good, So Safely Delicious – Safely Delicious® en Shopify none
allergyfreemarketplace.org 200 Allergy-Friendly Snacks - So Good, So Safely Delicious – Safely Delicious® en Shopify none
allergyfriendlymarket.com 200 Allergy-Friendly Snacks - So Good, So Safely Delicious – Safely Delicious® en Shopify none
allergyfriendlymarket.info 200 Allergy-Friendly Snacks - So Good, So Safely Delicious – Safely Delicious® en Shopify none
allergyfriendlymarket.org 200 Allergy-Friendly Snacks - So Good, So Safely Delicious – Safely Delicious® en Shopify none
allergyfriendlymarketplace.com 200 Allergy-Friendly Snacks - So Good, So Safely Delicious – Safely Delicious® en Shopify none
allergyfriendlymarketplace.info 200 Allergy-Friendly Snacks - So Good, So Safely Delicious – Safely Delicious® en Shopify none
allergyfriendlymarketplace.net 200 Allergy-Friendly Snacks - So Good, So Safely Delicious – Safely Delicious® en Shopify none
allergyfriendlymarketplace.org 200 Allergy-Friendly Snacks - So Good, So Safely Delicious – Safely Delicious® en Shopify none
alternutive.com 200 Home | Alternutive en Food AllergiesWordPressWooCommerce robots email none
betterwithbuckwheat.com 200 Maine Crisp Co. | Gluten Free Buckwheat Crackers Handmade in Maine en Desserts and BakingShopify none
blissbarz.com 200 Alio: Allergy Friendly Protein Bar! en Food and DrinkShopify robotsllms none
brothersallnatural.com 200 Freeze Dried Fruit | Fruit Crisps | Fruit Snacks en Food and DrinkBigCommerce robots none
bvesa.com parked 200 BVESA | Bedford Village Elementary School Association en Primary EducationWordPressWooCommerce none
cgnwalnuts.com 200 Crazy Go Nuts - Walnut Snacks – Crazy Go Nuts Walnuts en Food and DrinkShopifyX-Cart robotsllms none
clarenceschools.org 200 Home - Clarence Central School District en Education robots phone none
countryprime.com 200 Country Prime en Food and DrinkWordPressWooCommerce emailphone none
crazygonutswalnuts.com 200 Crazy Go Nuts - Walnut Snacks – Crazy Go Nuts Walnuts en Food and DrinkShopifyX-Cart robotsllms none
dessurtcorp.com 200 Buy Allergy Free Ice Cream | Nut-free, Egg-Free, and Sesame-Free Ice Cream Online - A La Mode en Desserts and BakingWordPressWooCommerce emailphone none
enjoylifefoods.ca 200 Enjoy Life Foods – Eat Freely Canada en Desserts and BakingWordPress robots none
enjoylifefoods.com 200 Eat Freely - Enjoy Life Foods® | Allergy Friendly & Gluten-Free‎ en Shopify robotsllms none
foodallergyparenting.com 200 Food Allergy Parenting en Children S HealthWordPressWooCommerce robots none
foodiekid.com 200 FoodieKid | Simple Starters - Baby Food, Your Way en Parenting Babies and ToddlersSquarespaceSquarespace Commerce robots none
fullychargedsnacks.com 200 Fully Charged Allergy Friendly Snacks en Food AllergiesShopifyX-Cart robotsllms none
glutenfreegloriously.com 200 Home | Two Fields Bakeshop en Desserts and BakingWordPressWooCommerce none
goodkarmafoods.com 200 Plant-Based Milk | Milk Substitute | Good Karma Foods en Healthy Cooking and EatingShopify robotsllms none
healthgardenusa.com 200 Home – HealthGarden en Healthy Cooking and EatingShopifyX-Cart robotsllms none
inbite.us 200 Gluten Free and Vegan Functional Oriented Bakery Products – Inbite United States en Vegan DietsShopify robotsllms emailphone none
indulgeright.com 200 Home » Indulge Right en Food and DrinkWordPress robotsllms none
jackfrancisfoods.com 200 Allergy-Free Chocolate Chip Cookies | Jack’s Allergen Friendly Bakery en Desserts and BakingWeeblyWooCommerce robots emailphone none
jjsbakery.com 200 Home | JJ's Bakery United States~ en Food and Drink robots none
jjsbakery.us 200 Home | JJ's Bakery United States en Food and Drink none
kimmiecandy.com 200 Kimmie Candy - Chocolate Candy Manufacture en Desserts and BakingShopify robots none
livealio.com 200 Alio: Allergy Friendly Protein Bar! en Food and DrinkShopify robotsllms none
mainecrisp.com 200 Maine Crisp Co. | Gluten Free Buckwheat Crackers Handmade in Maine en Desserts and BakingShopify robotsllms none
mastcellaware.com 200 MastCellAware :: Raising awareness of the important role that mast cells play in all our lives en Lung and Respiratory HealthWebflow none
mountainfreshice.com 200 Italian Ice en Food and Drink robots partial · 3
punkmamas.com 200 PUNK MAMAS | Raising the youth of today! en ParentingWordPress robots none
riceworks.com 200 Gluten Free Rice Chips - Riceworks en Healthy Cooking and EatingWordPressWooCommerce robots none
safely-delicious.biz 200 Allergy-Friendly Snacks - So Good, So Safely Delicious – Safely Delicious® en Shopify none
safely-delicious.co 200 Allergy-Friendly Snacks - So Good, So Safely Delicious – Safely Delicious® Colombia en Shopify none
safely-delicious.info 200 Allergy-Friendly Snacks - So Good, So Safely Delicious – Safely Delicious® en Shopify none
safely-delicious.mobi 200 Allergy-Friendly Snacks - So Good, So Safely Delicious – Safely Delicious® en Shopify none
safelydelicious.biz 200 Allergy-Friendly Snacks - So Good, So Safely Delicious – Safely Delicious® en Shopify none
safelydelicious.com 200 Allergy-Friendly Snacks - So Good, So Safely Delicious – Safely Delicious® en Shopify robotsllms none