| Domain | Match | Title | Country/Lang | Category | AI files | Contact | AI-protection |
|---|---|---|---|---|---|---|---|
| onlinemarketplacepanamacityfl.com ↗ | 69 match 2 shared topics |
Online Marketplace in Panama City, FL | Thetradingpost.ai | en | sales | robotsllmsaihumans | emailphone | partial · 8 |
| ondemandauctions.net ↗ | 65 match 2 shared topics |
Cyberauctions - Online Auctions | en | sales | robotsllmsaihumans | emailphone | none |
| sfhome4u.com ↗ | 65 match 2 shared topics |
Porkbun Marketplace: The domain SFhome4U.com is for sale. | en | sales | robotsllmsaihumans | emailphone | none |
| checkersindia.com ↗ | 65 match 2 shared topics |
Overstock auctions | Liquidation| Inventory | Electronics openbox l return inventory l Wholesale B2B marketplace India | en | sales | robotsllmsaihumans | emailphone | none |
| sfocybercab.com ↗ | 65 match 2 shared topics |
Porkbun Marketplace: The domain sfocybercab.com is for sale. | en | sales | robotsllmsaihumans | emailphone | none |
| servicesecovista.com ↗ | 65 match 2 shared topics |
Porkbun Marketplace: The domain servicesecovista.com is for sale. | en | sales | robotsllmsaihumans | emailphone | none |
| hamarasouk.com ↗ | 62 match 2 shared topics |
Hamara Souk – Buy. Sell. Smile | en | salesWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| offernaija.org ↗ | 62 match 2 shared topics |
OfferNaija | en | sales | robotsllmsaihumans | emailphone | none |
| queenofpawns.net ↗ | 62 match 2 shared topics |
The Best Pawnshop in Florida – Instant Cash Pawn, Sell for Cash, and Shop & Save | Queen of Pawns | en | sales | robotsllmsaihumans | emailphone | none |
| cashfasthomeseller.com ↗ | 62 match 2 shared topics |
Cash Fast Home Sellers | en | salesSquarespaceMagento | robotsllmsaihumans | emailphone | none |
| huntflipsell.com ↗ | 62 match 2 shared topics |
Home - My WordPress | en | salesWordPress | robotsllmsaihumans | emailphone | none |
| tweetchat.com ↗ | 62 match 2 shared topics |
TweetChat is a virtual meeting - Tweetchat | en | sales | robotsllmsaihumans | emailphone | none |
| credited.co.uk ↗ | 62 match 2 shared topics |
Backorder UK Domains | ukbackorder.uk | United Kingdom en | sales | robotsllmsaihumans | emailphone | none |
| cricketworldcup.co.uk ↗ | 62 match 2 shared topics |
Backorder UK Domains | ukbackorder.uk | United Kingdom en | sales | robotsllmsaihumans | emailphone | none |
| criminals.uk ↗ | 62 match 2 shared topics |
Backorder UK Domains | ukbackorder.uk | United Kingdom en | sales | robotsllmsaihumans | emailphone | none |
| crofter.co.uk ↗ | 62 match 2 shared topics |
Backorder UK Domains | ukbackorder.uk | United Kingdom en | sales | robotsllmsaihumans | emailphone | none |
| cruises.me.uk ↗ | 62 match 2 shared topics |
Backorder UK Domains | ukbackorder.uk | United Kingdom en | sales | robotsllmsaihumans | emailphone | none |
| cruisingexcursions.co.uk ↗ | 62 match 2 shared topics |
Backorder UK Domains | ukbackorder.uk | United Kingdom en | sales | robotsllmsaihumans | emailphone | none |