Piperic
similar sites
‹ ProfileAI Report

Sites similar to udealzone.com

Udealzone alternatives & similar sites

UDealZone - Buy & Sell Marketplace — 18 websites ranked by shared content topics, category and on-page relevance.

Each result shows its full tech stack, contacts and AI-policy — not just a name · Browse all sites in Sales →

DomainMatchTitleCountry/LangCategoryAI filesContactAI-protection
onlinemarketplacepanamacityfl.com 69 match
2 shared topics
Online Marketplace in Panama City, FL | Thetradingpost.ai en sales robotsllmsaihumans emailphone partial · 8
ondemandauctions.net 65 match
2 shared topics
Cyberauctions - Online Auctions en sales robotsllmsaihumans emailphone none
sfhome4u.com 65 match
2 shared topics
Porkbun Marketplace: The domain SFhome4U.com is for sale. en sales robotsllmsaihumans emailphone none
checkersindia.com 65 match
2 shared topics
Overstock auctions | Liquidation| Inventory | Electronics openbox l return inventory l Wholesale B2B marketplace India en sales robotsllmsaihumans emailphone none
sfocybercab.com 65 match
2 shared topics
Porkbun Marketplace: The domain sfocybercab.com is for sale. en sales robotsllmsaihumans emailphone none
servicesecovista.com 65 match
2 shared topics
Porkbun Marketplace: The domain servicesecovista.com is for sale. en sales robotsllmsaihumans emailphone none
hamarasouk.com 62 match
2 shared topics
Hamara Souk – Buy. Sell. Smile en salesWordPressWooCommerce robotsllmsaihumans emailphone none
offernaija.org 62 match
2 shared topics
OfferNaija en sales robotsllmsaihumans emailphone none
queenofpawns.net 62 match
2 shared topics
The Best Pawnshop in Florida – Instant Cash Pawn, Sell for Cash, and Shop & Save | Queen of Pawns en sales robotsllmsaihumans emailphone none
cashfasthomeseller.com 62 match
2 shared topics
Cash Fast Home Sellers en salesSquarespaceMagento robotsllmsaihumans emailphone none
huntflipsell.com 62 match
2 shared topics
Home - My WordPress en salesWordPress robotsllmsaihumans emailphone none
tweetchat.com 62 match
2 shared topics
TweetChat is a virtual meeting - Tweetchat en sales robotsllmsaihumans emailphone none
credited.co.uk 62 match
2 shared topics
Backorder UK Domains | ukbackorder.uk United Kingdom en sales robotsllmsaihumans emailphone none
cricketworldcup.co.uk 62 match
2 shared topics
Backorder UK Domains | ukbackorder.uk United Kingdom en sales robotsllmsaihumans emailphone none
criminals.uk 62 match
2 shared topics
Backorder UK Domains | ukbackorder.uk United Kingdom en sales robotsllmsaihumans emailphone none
crofter.co.uk 62 match
2 shared topics
Backorder UK Domains | ukbackorder.uk United Kingdom en sales robotsllmsaihumans emailphone none
cruises.me.uk 62 match
2 shared topics
Backorder UK Domains | ukbackorder.uk United Kingdom en sales robotsllmsaihumans emailphone none
cruisingexcursions.co.uk 62 match
2 shared topics
Backorder UK Domains | ukbackorder.uk United Kingdom en sales robotsllmsaihumans emailphone none

How the match score works

Each match is a 0–100 similarity score — the higher it is, the more two sites resemble one another. It’s computed automatically from our own crawl data (never from what a site says about itself) by combining several independent signals, so a high score means several of them point the same way:

No single signal decides the result — they’re blended together. Treat the score as a way to rank candidates rather than an absolute percentage; the chips on each result show which signals contributed.