| Domain | Match | Title | Country/Lang | Category | AI files | Contact | AI-protection |
|---|---|---|---|---|---|---|---|
| jelconstructioninc.com ↗ | 69 match 2 shared topics |
JEL Construction Inc. | Home Remodeling & Repairs in Pittsfield, MA | zx | remodeling-and-construction | robotsllmsaihumans | emailphone | none |
| omstructures.com ↗ | 68 match 2 shared topics |
Luxury Home Remodeling & Landscaping Services in Texas | zx | home-improvement | robotsllmsaihumans | emailphone | none |
| omstructuresllc.com ↗ | 68 match 2 shared topics |
Luxury Home Remodeling & Landscaping Services in Texas | zx | home-improvement | robotsllmsaihumans | emailphone | none |
| asroofingrepairllc.com ↗ | 66 match 2 shared topics |
A&S Roofing Repair Expert Roofing, Siding & Gutter Services | Home | zx | home-improvementWooCommerce | robotsllmsaihumans | emailphone | none |
| jclflooringinstallation.com ↗ | 65 match 2 shared topics |
Flooring Installation in Jupiter FL | Tile, Vinyl, Marble & Remodeling - JCL FLOORING INSTALLATION | zx | home-improvement | robotsllmsaihumans | emailphone | partial · 8 |
| 365roofs.com ↗ | 64 match 2 shared topics |
365 Roofs – Texas Year‑Round Roofing Solutions for Homes & Businesses - Residential & Commercial Roofing Services in Houston, Dallas, Austin – Free Estimates | United States~ zx | home-improvement | robotsllmsaihumans | emailphone | none |
| 1proroof.com ↗ | 64 match 2 shared topics |
1 Pro Roof – Texas Expert Residential & Commercial Roofing Services in Houston, Dallas, Austin – Free Estimates | United States~ zx | home-improvement | robotsllmsaihumans | emailphone | none |
| dmvroofingllc.com ↗ | 63 match 2 shared topics |
Roofing in Woodbridge, VA near me - Woodbridge Roofing | United States~ zx | home-improvementWordPress | robotsllmsaihumans | emailphone | partial · 8 |
| 247roofs.com ↗ | 63 match 2 shared topics |
24/7 Roofs – Texas Emergency Roofing & Repairs Around the Clock for Residential & Commercial Roofing Services in Houston, Dallas, Austin – Free Estimates | United States~ zx | home-improvement | robotsllmsaihumans | emailphone | none |
| astechnicalservice.com ↗ | 63 match 2 shared topics |
AL-SAFFAT TECHINCAL SERVICES | zx | home-improvement | robotsllmsaihumans | emailphone | none |
| chimneylosangeles.com ↗ | 63 match 2 shared topics |
Chimney Los Angeles | Sweep, Repair & Inspection Pros | zx | home-improvement | robotsllmsaihumans | emailphone | none |
| mckfirewaterdamagerestoration.com ↗ | 63 match 2 shared topics |
Water Damage Restoration in Addison, IL near me - Addison Water Damage Restoration | United States~ zx | home-improvementWordPress | robotsllmsaihumans | emailphone | partial · 8 |
| jcmfloorings.com ↗ | 63 match 2 shared topics |
Flooring in Baldwin Park, CA near me - Baldwin Park Flooring | United States~ zx | home-improvementWordPress | robotsllmsaihumans | emailphone | partial · 8 |
| kattumadamcentra.com ↗ | 63 match 2 shared topics |
Kattumadam Centra – Quality Building Materials | zx | remodeling-and-construction | robotsllmsaihumans | emailphone | none |
| jerrychimneysweeprepairservice.com ↗ | 62 match 2 shared topics |
Jerry Chimney Sweep Repair Service | United States~ zx | home-improvementWordPress | robotsllmsaihumans | emailphone | none |
| 1-plumbing.com ↗ | 62 match 2 shared topics |
Local Plumbers - Plumbing Repair, Installation And Inspection Company | zx | home-improvement | robotsllmsaihumans | emailphone | none |
| atsconstructionwa.com ↗ | 62 match 2 shared topics |
Tile Installer in Kirkland, WA near me - Kirkland Tile Installer | United States~ zx | home-improvementWordPress | robotsllmsaihumans | emailphone | partial · 8 |
| mikehansenroofing.com ↗ | 62 match 2 shared topics |
Mike Hansen Roofing | Roofing / Siding, Gutters. Mankato, Lake Crystal | United States~ zx | home-improvement | robotsllmsaihumans | emailphone | none |