| Domain | Match | Title | Country/Lang | Category | AI files | Contact | AI-protection |
|---|---|---|---|---|---|---|---|
| csdischarge.com ↗ | 64 match 1 shared topics |
Child Support Discharge | en | lawShopifyX-Cart | robotsllmsaihumans | emailphone | none |
| mediatethurston.org ↗ | 64 match 1 shared topics |
Dispute Resolution Center | United States~ en | lawWeebly | robotsllmsaihumans | emailphone | none |
| donotappeal.com ↗ | 64 match 1 shared topics |
DoNotAppeal.com — Fight Unfair Parking Tickets | en | law | robotsllmsaihumans | emailphone | none |
| mediationsolution.org ↗ | 63 match 1 shared topics |
Mediation Solutions – Alternative Dispute Resolutions (ADR) | en | lawWordPress | robotsllmsaihumans | emailphone | none |
| bestvirginiaspeedingticket.lawyer ↗ | 63 match 1 shared topics |
Best Virginia Speeding Ticket Lawyer – Defense for Traffic Ticket Charges in Virginia | en | lawWordPress | robotsllmsaihumans | emailphone | none |
| mcdonaldandmcdonald.com ↗ | 63 match 1 shared topics |
Mcdonald and Mcdonald - Disability Attorneys | en | lawWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| theinsuranceattorneys.com ↗ | 63 match 1 shared topics |
Insurance Dispute Lawyer Oklahoma City | Bad Faith Insurance Attorneys | Oklahoma Insurance Lawyers | Denied Claims | en | lawWordPress | robotsllmsaihumans | emailphone | none |
| cstewartlaw.com ↗ | 63 match 1 shared topics |
Wills and Trusts Attorney | Philadelphia | Clair M. Stewart | en | law | robotsllmsaihumans | emailphone | none |
| newyorksolarproblems.com ↗ | 63 match 1 shared topics |
Legal Disputes in Solar Energy - The Law Offices of John Caravella, P.C. | en | lawWordPress | robotsllmsaihumans | emailphone | none |
| newyorksolarissues.com ↗ | 63 match 1 shared topics |
Legal Disputes in Solar Energy - The Law Offices of John Caravella, P.C. | en | lawWordPress | robotsllmsaihumans | emailphone | none |
| queensdomesticviolencelawyer.com ↗ | 62 match 1 shared topics |
Queens County Domestic Violence Lawyer - False Domestic Violence Charges - Domestic Violence Attorney - New York City Domestic Violence Attorney | en | law | robotsllmsaihumans | emailphone | none |
| mcdlaw.org ↗ | 62 match 1 shared topics |
Wyoming Trust Attorneys | United States~ en | law | robotsllmsaihumans | emailphone | none |
| mcdanielreport.io ↗ | 62 match 1 shared topics |
Wyoming Trust Attorneys | United States~ en | law | robotsllmsaihumans | emailphone | none |
| mcdaniellawllc.com ↗ | 62 match 1 shared topics |
Wyoming Trust Attorneys | United States~ en | law | robotsllmsaihumans | emailphone | none |
| antitru.st ↗ | 62 match 1 shared topics |
Antitrust | Barak Orbach | en | lawWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| queensdomesticviolenceattorney.com ↗ | 62 match 1 shared topics |
Queens Domestic Violence Lawyer | Lawyer in Queens to Domestic Violence Charges | Domestic Violence Lawyer | en | law | robotsllmsaihumans | emailphone | none |
| cryptotrustandwill.com ↗ | 62 match 1 shared topics |
Cryptotrustandwill | Home | en | law | robotsllmsaihumans | emailphone | none |
| gunterautoinjury.com ↗ | 62 match 1 shared topics |
Provo's Top Car Accident Lawyer – Get Fair Compensation! | en | lawWordPress | robotsllmsaihumans | emailphone | none |