| Domain | Match | Title | Country/Lang | Category | AI files | Contact | AI-protection |
|---|---|---|---|---|---|---|---|
| lynnwoodtix.com ↗ | 70 match 1 shared topics |
Pay Tickets Online - Lynnwood, Washington, Lynnwood Municipal Court | en | law | robotsllmsaihumans | emailphone | none |
| clintoncityincourt.com ↗ | 70 match 1 shared topics |
Pay Tickets Online - Clinton, Indiana, City Court of Clinton Indiana | en | law | robotsllmsaihumans | emailphone | none |
| springvalleyparking.com ↗ | 70 match 1 shared topics |
Pay Tickets Online - Spring Valley, New York, Village of Spring Valley Justice Court | en | law | robotsllmsaihumans | emailphone | none |
| bestvirginiaspeedingticket.lawyer ↗ | 69 match 1 shared topics |
Best Virginia Speeding Ticket Lawyer – Defense for Traffic Ticket Charges in Virginia | en | lawWordPress | robotsllmsaihumans | emailphone | none |
| speedingticketsontario.com ↗ | 68 match 1 shared topics |
Challenging Speeding Tickets in Ontario | en | law | robotsllmsaihumans | emailphone | none |
| 4jdc.com ↗ | 66 match 1 shared topics |
4th Judicial District Court Online Court | en | lawSquarespace | robotsllmsaihumans | emailphone | none |
| romulusticket.com ↗ | 65 match 1 shared topics |
Romulus Ticket | en | lawWordPress | robotsllmsaihumans | emailphone | none |
| alimonytracker.com ↗ | 65 match 1 shared topics |
Alimony Tracker — Support Payment Records for Court Documentation | en | law | robotsllmsaihumans | emailphone | none |
| njspeeding.com ↗ | 65 match 1 shared topics |
Palisades Interstate Parkway Court Speeding ticket Lawyer NJ | United States~ en | law | robotsllmsaihumans | emailphone | none |
| squashmyticket.com ↗ | 65 match 1 shared topics |
Squash My Ticket - Your Trusted Ticket Group | en | lawWordPress | robotsllmsaihumans | emailphone | none |
| closeestate.info ↗ | 64 match 1 shared topics |
Settle the estate online with Elayne | en | law | robotsllmsaihumans | emailphone | none |
| closeestatenow.info ↗ | 64 match 1 shared topics |
Settle the estate online with Elayne | en | law | robotsllmsaihumans | emailphone | none |
| closeestate.live ↗ | 64 match 1 shared topics |
Settle the estate online with Elayne | en | law | robotsllmsaihumans | emailphone | none |
| 2fixyourtrafficticket.com ↗ | 64 match 1 shared topics |
$99 Flat Fee 100% Money Back Fight Speeding Ticket in California | United States~ en | law | robotsllmsaihumans | emailphone | none |
| cssprobationpymts.com ↗ | 64 match 1 shared topics |
Pay Probation Online - Greenville, Georgia, CSS Probation | en | law | robotsllmsaihumans | emailphone | none |
| clerkmichelle.net ↗ | 64 match 1 shared topics |
Saint Lucie County Clerk of the Circuit Court Website | en | lawJoomla | robotsllmsaihumans | emailphone | none |
| clerkmichellemiller.com ↗ | 64 match 1 shared topics |
Saint Lucie County Clerk of the Circuit Court Website | en | lawJoomla | robotsllmsaihumans | emailphone | none |
| claimsora.legal ↗ | 64 match 1 shared topics |
Claimsora | Ontario Personal Injury Lawyers - Free Consultation | en | law | robotsllmsaihumans | emailphone | none |