similar sites

Browse

Pricing AI Report

Tools

🚀Submit Your Site to AIPush your URL to AI search engines 🤖AI Crawler CheckerSee which AI bots your site blocks 🎯AI Readiness CheckerScore your site 0–100 for AI 🔗Backlink CheckerWho links to any site — free All tools →

Browse free →

Sites similar to tidalagencygravitas.com

Tidalagencygravitas alternatives & similar sites

Highline Digital Marketing LLC — 18 websites ranked by shared content topics, category and on-page relevance.

Each result shows its full tech stack, contacts and AI-policy — not just a name · Browse all sites in Marketing And Advertising →

Domain	Match	Title	Country/Lang	Category	AI files	Contact	AI-protection
360digimktg.com ↗	82 match 1 shared topics	360 Digital Marketing LLC	en	marketing-and-advertising Lightspeed	robotsllmsaihumans	emailphone	none
onlinedigitalmarketingsales.com ↗	81 match 1 shared topics	Online Digital Marketing Sales	en	marketing-and-advertising	robotsllmsaihumans	emailphone	partial · 8
4thweb.com ↗	80 match 1 shared topics	Digital Marketing	en	marketing-and-advertising WordPress WooCommerce	robotsllmsaihumans	emailphone	none
3sixtyevolution.com ↗	80 match 1 shared topics	3sixty Digital Marketing	en	marketing-and-advertising	robotsllmsaihumans	emailphone	none
mediapiston.net ↗	80 match 1 shared topics	Full Service Digital Marketing Agency	en	marketing-and-advertising WordPress	robotsllmsaihumans	email phone	none
onlinedigitalcard.com ↗	79 match 1 shared topics	Online Digital Card \| Digital Marketing Agency	en	marketing-and-advertising WordPress WooCommerce	robots llmsaihumans	emailphone	none
360plusmedia.site ↗	79 match 1 shared topics	Digital Marketing Agency	en	marketing-and-advertising WordPress WooCommerce	robotsllmsaihumans	email phone	none
sandifund.com ↗	79 match 1 shared topics	Mcat Digital Marketing Agency	en	marketing-and-advertising WordPress	robotsllmsaihumans	emailphone	partial · 8
landscapingdigitalmarketing.com ↗	79 match 1 shared topics	Landscaping Digital Marketing	United States~ en	marketing-and-advertising	robotsllmsaihumans	emailphone	none
lawfirmdigitalmarketingagency.com ↗	79 match 1 shared topics	Law Firm Digital Marketing	en	marketing-and-advertising WordPress	robots llmsaihumans	email phone	none
onpointlocal.com ↗	79 match 1 shared topics	onPoint Digital Marketing	en	marketing-and-advertising	robotsllmsaihumans	emailphone	none
cottondigitalmarketing.com ↗	78 match 1 shared topics	Cotton Digital Marketing	en	marketing-and-advertising	robotsllmsaihumans	emailphone	none
thewemark.com ↗	78 match 1 shared topics	Digital Marketing Agency - Wemark	en	marketing-and-advertising WordPress WooCommerce	robotsllmsaihumans	emailphone	none
a3digitalmarketing.com ↗	78 match 1 shared topics	Home - A3 Digital Marketing	en	marketing-and-advertising WordPress WooCommerce	robotsllmsaihumans	emailphone	none
topmediadigitalmarketing.com ↗	78 match 1 shared topics	TopMedia Digital Marketing	United States~ en	marketing-and-advertising	robots llmsaihumans	emailphone	none
3techagency.com ↗	78 match 1 shared topics	3techagency \| Digital Marketing Agency	en	marketing-and-advertising WordPress	robotsllmsaihumans	email phone	none
2treesppc.com ↗	78 match 1 shared topics	Two Trees Digital Marketing	en	marketing-and-advertising HubSpot	robotsllmsaihumans	emailphone	none
couchdeck.com ↗	78 match 1 shared topics	Couchdeck Digital Marketing Company	India~ en	marketing-and-advertising WordPress	robotsllmsaihumans	email phone	partial · 1

How the match score works

Each match is a 0–100 similarity score — the higher it is, the more two sites resemble one another. It’s computed automatically from our own crawl data (never from what a site says about itself) by combining several independent signals, so a high score means several of them point the same way:

shared topics how many of the same fine‑grained content topics (IAB sub‑categories) both sites cover — the main signal.
same category whether they sit in the same business / industry category.
content & title how closely their titles and page descriptions line up in wording and meaning.

No single signal decides the result — they’re blended together. Treat the score as a way to rank candidates rather than an absolute percentage; the chips on each result show which signals contributed.