| Domain | Match | Title | Country/Lang | Category | AI files | Contact | AI-protection |
|---|---|---|---|---|---|---|---|
| cmzlaw.net ↗ | 67 match 1 shared topics |
CMZ Law: Your Trusted Personal Injury Lawyers | en | lawWordPress | robotsllmsaihumans | emailphone | none |
| adminpenaltysystem.online ↗ | 65 match 1 shared topics |
Pay Tickets Online | File Ontario Traffic Tickets For Court | en | law | robotsllmsaihumans | emailphone | none |
| administrativepenaltysystem.services ↗ | 65 match 1 shared topics |
Pay Tickets Online | File Ontario Traffic Tickets For Court | en | law | robotsllmsaihumans | emailphone | none |
| administrativepenaltysystem.net ↗ | 65 match 1 shared topics |
Pay Tickets Online | File Ontario Traffic Tickets For Court | en | law | robotsllmsaihumans | emailphone | none |
| bestvirginiaspeedingticket.lawyer ↗ | 64 match 1 shared topics |
Best Virginia Speeding Ticket Lawyer – Defense for Traffic Ticket Charges in Virginia | en | lawWordPress | robotsllmsaihumans | emailphone | none |
| macombticket.com ↗ | 64 match 1 shared topics |
Macomb Ticket | en | lawWordPress | robotsllmsaihumans | emailphone | none |
| clintontownshiptickethelp.com ↗ | 64 match 1 shared topics |
Clinton Township Ticket Help | en | lawWordPress | robotsllmsaihumans | emailphone | none |
| romulusticket.com ↗ | 64 match 1 shared topics |
Romulus Ticket | en | lawWordPress | robotsllmsaihumans | emailphone | none |
| carenalert.com ↗ | 64 match 1 shared topics |
C.A.R.E.N.™ Alert - Your Roadside Guardian | en | law | robotsllmsaihumans | emailphone | none |
| lvgp2023ticketsettlement.com ↗ | 64 match 1 shared topics |
LVGP 2023 TICKET SETTLEMENT | Home | United States~ en | law | robotsllmsaihumans | emailphone | none |
| thegoodspider.com ↗ | 64 match 1 shared topics |
Make The Case - Your Law Partners | en | lawWordPress | robotsllmsaihumans | emailphone | partial · 8 |
| custodybinder.com ↗ | 63 match 1 shared topics |
CustodyBinder - Your case, organized | en | law | robotsllmsaihumans | emailphone | none |
| lecceselaw.com ↗ | 63 match 1 shared topics |
Leccese Law - Trusted Massachusetts Estate Planning | en | lawWeebly | robotsllmsaihumans | emailphone | none |
| madisonheightsticket.com ↗ | 63 match 1 shared topics |
Madison Heights Ticket | en | lawWordPress | robotsllmsaihumans | emailphone | none |
| nomittvp.com ↗ | 63 match 1 shared topics |
Lawspective - Your solutions start here | en | lawWordPress | robotsllmsaihumans | emailphone | partial · 8 |
| romboutshouselawfirm.com ↗ | 63 match 1 shared topics |
Home - Rombouts House Law Firm || No.1 Trusted Law Firm | en | lawWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| 4immigrant.com ↗ | 63 match 1 shared topics |
4immigrant.com - Your guide to Citizenship | en | law | robotsllmsaihumans | emailphone | none |
| heimerlaw.com ↗ | 63 match 1 shared topics |
Heimer Law - Adoption Services - Trusted Adoption Law Firm | en | lawWordPressWooCommerce | robotsllmsaihumans | emailphone | none |