| Domain | Match | Title | Country/Lang | Category | AI files | Contact | AI-protection |
|---|---|---|---|---|---|---|---|
| robonk.com ↗ | 66 match 1 shared topics |
Robonk AI Comic Strip | Artificial Intelligence | en | comics-and-graphic-novelsWordPress | robotsllmsaihumans | emailphone | none |
| anecdotesofahyperlyselfawaremiddleclasshuman.com ↗ | 65 match 1 shared topics |
Anecdotes of a Hyperly-Self-Aware-Middle-Class Human – A philosophical web comic strip | en | comics-and-graphic-novelsWordPress | robotsllmsaihumans | emailphone | none |
| jerkyprinter.com ↗ | 64 match 1 shared topics |
The Island — Moloch's Dark Political Comics | The Island | en | comics-and-graphic-novels | robotsllmsaihumans | emailphone | none |
| dossvinci.com ↗ | 63 match 1 shared topics |
My name is Eve. | en | comics-and-graphic-novels | robotsllmsaihumans | emailphone | none |
| csmithartstore.com ↗ | 63 match 1 shared topics |
Cory Smith Comic Art Store – csmithartstore | en | comics-and-graphic-novelsShopify | robotsllmsaihumans | emailphone | none |
| jaysbackend.com ↗ | 63 match 1 shared topics |
Jay Britton's Phantasmagorical Adventures | en | comics-and-graphic-novels | robotsllmsaihumans | emailphone | none |
| jaysfrontend.com ↗ | 63 match 1 shared topics |
Jay Britton's Phantasmagorical Adventures | en | comics-and-graphic-novels | robotsllmsaihumans | emailphone | none |
| dotshin.com ↗ | 63 match 1 shared topics |
DotShin — Create Manga That Tells Your Story | en | comics-and-graphic-novels | robotsllmsaihumans | emailphone | none |
| nexawiki.com ↗ | 63 match 1 shared topics |
Nexa Wiki — A Community-Run Wiki Network | en | comics-and-graphic-novels | robotsllmsaihumans | emailphone | none |
| blindscience.com ↗ | 63 match 1 shared topics |
Blind Science Design | United States~ en | comics-and-graphic-novelsSquarespaceLightspeed | robotsllmsaihumans | emailphone | partial · 13 |
| mcfarland-entertainment.com ↗ | 63 match 1 shared topics |
Comics | McFarland Entertainment | en | comics-and-graphic-novelsWeeblySquare Online | robotsllmsaihumans | emailphone | none |
| acryden.com ↗ | 63 match 1 shared topics |
The Acryden: A Graphic Novel of Magic and Adventure - The Acryden | en | comics-and-graphic-novelsWordPress | robotsllmsaihumans | emailphone | partial · 8 |
| qomixclassics.com ↗ | 62 match 1 shared topics |
Auteur Global | Creative Syndicate for the Future of Storytelling | en | comics-and-graphic-novels | robotsllmsaihumans | emailphone | none |
| doodlesandplay.com ↗ | 62 match 1 shared topics |
Doodles and Play – A place to experiment with visual story tales. | en | comics-and-graphic-novelsWordPress | robotsllmsaihumans | emailphone | none |
| anarchychess.world ↗ | 62 match 1 shared topics |
BinRaids — Comic Marketplace | en | comics-and-graphic-novels | robotsllmsaihumans | emailphone | none |
| robotswithcoffee.com ↗ | 62 match 1 shared topics |
Robots With Coffee – comic strips – reviews – coffee | en | comics-and-graphic-novelsWordPress | robotsllmsaihumans | emailphone | none |
| megaflowgraphics.com ↗ | 62 match 1 shared topics |
Megaflow Graphics | en | comics-and-graphic-novelsSquarespaceSquarespace Commerce | robotsllmsaihumans | emailphone | none |
| acrossthegrooves.com ↗ | 62 match 1 shared topics |
Across the Grooves – An Interactive Graphic Novel | en | comics-and-graphic-novelsWordPress | robotsllmsaihumans | emailphone | none |