| Domain | Match | Title | Country/Lang | Category | AI files | Contact | AI-protection |
|---|---|---|---|---|---|---|---|
| allcolorscarpetclean.com ↗ | 72 match 1 shared topics |
Indy All Pros Carpet Cleaning, Stretching And Repair LLC | en | home-improvementWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| alexscarpetcleaningnc.com ↗ | 70 match 1 shared topics |
Alex’s Carpet Cleaning | Carpet Cleaning in Charlotte | United States~ en | home-improvementLightspeed | robotsllmsaihumans | emailphone | none |
| shorelinecarpetwa.com ↗ | 70 match 1 shared topics |
Shoreline Carpet Cleaning Company | Carpet Cleaning Services | United States~ en | home-improvement | robotsllmsaihumans | emailphone | none |
| conleyscarpetcleaningplus.com ↗ | 70 match 1 shared topics |
Conley's Carpet Cleaning in Virginia Beach, VA | en | home-improvementWordPress | robotsllmsaihumans | emailphone | none |
| meadowwoodscarpetcleaningservice.com ↗ | 69 match 1 shared topics |
Meadow Woods Carpet Cleaning | (407) 495-2693 | en | home-improvement | robotsllmsaihumans | emailphone | none |
| oviedocarpetcleaningservice.com ↗ | 69 match 1 shared topics |
Oviedo Carpet Cleaning | (407) 440-0934 | en | home-improvement | robotsllmsaihumans | emailphone | none |
| lakemarycarpetcleaningservice.com ↗ | 69 match 1 shared topics |
Lake Mary Carpet Cleaning | (407) 440-0901 | en | home-improvement | robotsllmsaihumans | emailphone | none |
| palmerscarpet.com ↗ | 68 match 1 shared topics |
Home - Palmer's Carpet Cleaning and Restoration | en | home-improvementWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| allamericaninitiative.com ↗ | 68 match 1 shared topics |
Top Rated CARPET Cleaning / Re stretch, Home Repairs, Junk Removal | en | home-improvementWordPress | robotsllmsaihumans | emailphone | none |
| allgaragedoorrepairllc.com ↗ | 68 match 1 shared topics |
Garage Door Repair Milwaukee WI | Spring & Cable Repair | All Garage Door Repair LLC | All Garage Door Repair LLC | en | home-improvement | robotsllmsaihumans | emailphone | none |
| agcarpetspecialist.co.uk ↗ | 68 match 1 shared topics |
Expert Carpet Cleaning in Cheltenham | AG Carpet Specialist | United Kingdom en | home-improvementWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| shureclean.com ↗ | 68 match 1 shared topics |
Carpet Cleaning - We come to you :) See our service areas from Atlanta to Kennesaw. – Carpet Stretching, Cleaning, Repair - Acworth, Woodstock, Kennesaw | en | home-improvementWordPress | robotsllmsaihumans | emailphone | none |
| crystalvistawc.com ↗ | 68 match 1 shared topics |
Professional Window Cleaning Services in Waukesha, Milwaukee | en | home-improvementWordPress | robotsllmsaihumans | emailphone | none |
| crystalcleanservices.pro ↗ | 68 match 1 shared topics |
Crystal Clean: Window & Carpet Cleaning in Sioux Falls, SD | en | home-improvementWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| eufaulagleamteam.com ↗ | 68 match 1 shared topics |
Eufaula Gleam: Expert Cleaning & Home Repair Services | en | home-improvement | robotsllmsaihumans | emailphone | none |
| ctmcarpetcare.net ↗ | 68 match 1 shared topics |
Carpet Repair CTM | en | home-improvement | robotsllmsaihumans | emailphone | none |
| pacificshorescarpetcare.com ↗ | 67 match 1 shared topics |
Pacific Shores Carpet Care | Professional Carpet Cleaning San Diego | (619) 865-1432 | United States~ en | home-improvement | robotsllmsaihumans | emailphone | none |
| 360touchcleaning.com ↗ | 67 match 1 shared topics |
360 Touch Cleaning Services | en | home-improvement | robotsllmsaihumans | emailphone | none |