| Domain | Match | Title | Country/Lang | Category | AI files | Contact | AI-protection |
|---|---|---|---|---|---|---|---|
| lasallecountymining.org ↗ | 63 match 2 shared topics |
LaSalle County Mining | en | construction-industry | robotsllmsaihumans | emailphone | none |
| hhreinforcement.com ↗ | 63 match 2 shared topics |
Home | Haji Hassan Reinforcements | en | construction-industryWordPress | robotsllmsaihumans | emailphone | none |
| ashapura.com ↗ | 63 match 2 shared topics |
Home | Ashapura | en | construction-industryWebflow | robotsllmsaihumans | emailphone | none |
| 3daluminium.co.uk ↗ | 63 match 2 shared topics |
Home | 3d Aluminium | United Kingdom en | construction-industryWordPress | robotsllmsaihumans | emailphone | none |
| pongalurinfragreen.com ↗ | 63 match 2 shared topics |
Infra Green – Manufactured by Pongalur Infra Roofings Pvt Ltd | en | construction-industryWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| landmarkmetal.com ↗ | 62 match 2 shared topics |
Home - Landmark Metal Builders | en | construction-industryWordPress | robotsllmsaihumans | emailphone | none |
| algargllc.com ↗ | 62 match 2 shared topics |
Home - AL GARG Steel & Aluminium Tr.LLC | en | metals-industryWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| 4summit.co.uk ↗ | 62 match 2 shared topics |
Home | FourSummit | United Kingdom en | construction-industry | robotsllmsaihumans | emailphone | partial · 8 |
| 2apextrade.com ↗ | 62 match 2 shared topics |
Home - | en | metals-industryWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| conares.com ↗ | 62 match 2 shared topics |
Home - Conares | en | metals-industryWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| conleysteel.com ↗ | 62 match 2 shared topics |
Conley Steel, Inc. | Chicago Steel Services | en | construction-industry | robotsllmsaihumans | emailphone | none |
| pacificsteelfabrication.com ↗ | 62 match 2 shared topics |
Pacific Steel Fabrication & Sandblasting Pty Ltd | welding structural steel | Central Coast NSW, Australia | en | metals-industryWix | robotsllmsaihumans | emailphone | none |
| 4brotherssheetmetal.com ↗ | 62 match 2 shared topics |
Home - 4 Brothers Sheet Metal | en | metals-industryWordPress | robotsllmsaihumans | emailphone | none |
| alcarconstructors.com ↗ | 62 match 2 shared topics |
Home Page | Alcar Constructors | General contractors licensed in NC, SC, VA, & AL | United States~ en | construction-industry | robotsllmsaihumans | emailphone | none |
| dhatablasting.com ↗ | 62 match 2 shared topics |
Dhata Blasting Co | Sand Blasting | Shot Blasting | Metallizing |Shot Blasting Machine | Metallizing Gun | Corrosion Prevention of Large Steel Structure | Blasting and Metallizing Services in Kolkata, India | en | metals-industryWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| mckinneysteel.com ↗ | 62 match 2 shared topics |
McKinney Steel | en | construction-industryWordPress | robotsllmsaihumans | emailphone | none |
| alhaddafalaqwiyarawmaterials.com ↗ | 62 match 2 shared topics |
Home - AL HADDAF AL AQWIYA TRADING OF MATERIALS AND RAW MATERIALS COMPANY - BFC | en | metals-industryWordPress | robotsllmsaihumans | emailphone | none |
| heshenggro.com ↗ | 62 match 2 shared topics |
Metal Perforated Cable Tray, Metal Cable Ladder - Hesheng | Hesheng Group Co., Ltd. | en | construction-industry | robotsllmsaihumans | emailphone | none |