| Domain | Match | Title | Country/Lang | Category | AI files | Contact | AI-protection |
|---|---|---|---|---|---|---|---|
| laminitishelp.org ↗ | 63 match 1 shared topics |
Laminitis in Horses | en | veterinary-medicineWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| laminitisclinic.org ↗ | 63 match 1 shared topics |
Laminitis Clinic advice for horse owners | en | veterinary-medicine | robotsllmsaihumans | emailphone | none |
| herdid.com ↗ | 63 match 1 shared topics |
HerdID: Digital Horse Passports & Vet-Verified Health Records | en | veterinary-medicine | robotsllmsaihumans | emailphone | none |
| beachequine.com ↗ | 62 match 1 shared topics |
Myrtle Beach Equine Clinic | Horse Vet | Longs, Conway, SC | en | veterinary-medicineWix | robotsllmsaihumans | emailphone | none |
| 3dvetanatomize.com ↗ | 62 match 1 shared topics |
A 3D printed model of the horse distal limb - 3D Vet Anatomize | en | veterinary-medicineWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| packupsweeps.com ↗ | 62 match 1 shared topics |
Pickup Pack-up Sweepstakes - Merck Animal Health USA | en | veterinary-medicineWordPress | robotsllmsaihumans | emailphone | none |
| pondcarevet.com ↗ | 62 match 1 shared topics |
Pond Care Veterinary · Precision aquaculture · Health · Efficiency · Sustainability | en | veterinary-medicine | robotsllmsaihumans | emailphone | none |
| lakeroadanimalhospital.com ↗ | 61 match 1 shared topics |
Lake Road Animal Hospital - Horseheads, New York, 14845 | en | veterinary-medicineWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| medika.pet ↗ | 61 match 1 shared topics |
Medika - Pet health record | en | veterinary-medicine | robotsllmsaihumans | emailphone | none |
| conroevet.com ↗ | 61 match 1 shared topics |
Conroe Vet Clinic - Pets, Horses, Livestock | (936) 756-5233Conroe Veterinary Clinic | en | veterinary-medicineWordPress | robotsllmsaihumans | emailphone | none |
| pacificcreekveterinaryservice.com ↗ | 61 match 1 shared topics |
Home Page - Pacific Creek Veterinary Service | en | veterinary-medicineWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| pacificavenuevetclinic.com ↗ | 61 match 1 shared topics |
Animal Hospital & Veterinarian in Forest Grove, OR | Paci... | United States~ en | veterinary-medicine | robotsllmsaihumans | emailphone | none |
| vmedtechnology.com ↗ | 61 match 1 shared topics |
Veterinary Monitors For Surgery, ECG, Blood Pressure | en | veterinary-medicineWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| ethosmed.com ↗ | 61 match 1 shared topics |
EthosMED - Human & Veterinary PACS & Teleradiology Solutions | en | veterinary-medicine | robotsllmsaihumans | emailphone | none |
| shopsmarttag.com ↗ | 61 match 1 shared topics |
VetVerifi | Verified Vaccination Records for Pet Care | en | veterinary-medicine | robotsllmsaihumans | emailphone | none |
| pacificveterinaryclinic.com ↗ | 61 match 1 shared topics |
Veterinary Hospital In Grants Pass, OR | Pacific Veterinary Clinic | en | veterinary-medicineWordPressLightspeed | robotsllmsaihumans | emailphone | none |
| pacificveterinaryhospital.com ↗ | 61 match 1 shared topics |
Veterinary Care in Portland, OR | Pacific Veterinary Hospital | en | veterinary-medicine | robotsllmsaihumans | emailphone | none |
| baywestac.com ↗ | 61 match 1 shared topics |
Veterinarians in Traverse City: Rebekah E. Fahey & Matthew P. Fain | en | veterinary-medicineWix | robotsllmsaihumans | emailphone | none |