| Domain | Match | Title | Country/Lang | Category | AI files | Contact | AI-protection |
|---|---|---|---|---|---|---|---|
| minidentalimplantspolkcityia.com ↗ | 87 match 2 shared topics |
Mini Dental Implants | Albia, IA | Heritage Dental | en | dental-healthWordPress | robotsllmsaihumans | emailphone | none |
| minidentalimplantsalbiaia.com ↗ | 87 match 2 shared topics |
Mini Dental Implants | Albia, IA | Heritage Dental | en | dental-healthWordPress | robotsllmsaihumans | emailphone | none |
| minidentalimplantsrathdrumid.com ↗ | 87 match 2 shared topics |
Mini Dental Implants | Rathdrum, ID | Rathdrum Dental | en | dental-healthWordPress | robotsllmsaihumans | emailphone | none |
| minidentalimplantsmartintn.com ↗ | 87 match 2 shared topics |
Mini Dental Implants | Martin, TN | Moore Dental Office | en | dental-healthWordPress | robotsllmsaihumans | emailphone | none |
| minidentalimplantsbangorme.com ↗ | 87 match 2 shared topics |
Mini Dental Implants | Bangor, ME | Sedation Dental | en | dental-healthWordPress | robotsllmsaihumans | emailphone | none |
| minidentalimplantselkonv.com ↗ | 86 match 2 shared topics |
Mini Dental Implants | Elko, NV | Cruson Dental Arts | en | dental-healthWordPress | robotsllmsaihumans | emailphone | none |
| minidentalimplantscromwellct.com ↗ | 86 match 2 shared topics |
Mini Dental Implants | Cromwell, CT | Nova Dental | en | dental-healthWordPress | robotsllmsaihumans | emailphone | none |
| minidentalimplantslakecityfl.com ↗ | 86 match 2 shared topics |
Mini Dental Implants | Lake City, FL | Aspire Dental Group | en | dental-healthWordPress | robotsllmsaihumans | emailphone | none |
| minidentalimplantscolumbusoh.com ↗ | 86 match 2 shared topics |
Mini Dental Implants | Columbus, OH | Lifetime Dental Health | en | dental-healthWordPress | robotsllmsaihumans | emailphone | none |
| minidentalimplantssomersworthnh.com ↗ | 86 match 2 shared topics |
Mini Dental Implants | Somersworth, NH | Great Falls Dental | en | dental-healthWordPress | robotsllmsaihumans | emailphone | none |
| minidentalimplantskingstonny.com ↗ | 86 match 2 shared topics |
Mini Dental Implants | Kingston, NY | Oppenheimer Dentistry | en | dental-healthWordPress | robotsllmsaihumans | emailphone | none |
| minidentalimplantsbolivarmo.com ↗ | 85 match 2 shared topics |
Mini Dental Implants | Bolivar, MO | Bolivar Smiles Dentistry | en | dental-healthWordPress | robotsllmsaihumans | emailphone | none |
| minidentalimplantsmilwaukeewi.com ↗ | 84 match 2 shared topics |
Mini Dental Implants | Milwaukee, WI | Brian C. Rau, DDS | en | dental-healthWordPress | robotsllmsaihumans | emailphone | none |
| minidentalimplantsfairfieldoh.com ↗ | 84 match 2 shared topics |
Mini Dental Implants | Fairfield, OH | Fairfield Family Dentistry | en | dental-healthWordPress | robotsllmsaihumans | emailphone | none |
| minidentalimplantseagleriverwi.com ↗ | 84 match 2 shared topics |
Mini Dental Implants | Eagle River, WI | Potrykus Family Dentistry | en | dental-healthWordPress | robotsllmsaihumans | emailphone | none |
| minidentalimplantsdicksontn.com ↗ | 84 match 2 shared topics |
Mini Dental Implants | Dickson, TN | Dr. Dave's Healthy Smiles | en | dental-healthWordPress | robotsllmsaihumans | emailphone | none |
| minidentalimplantscovingtonla.com ↗ | 83 match 2 shared topics |
Mini Dental Implants | Covington, LA | Covington Mini Dental Implant Center Of America | en | dental-healthWordPress | robotsllmsaihumans | emailphone | none |
| minidentalimplantsofkc.com ↗ | 75 match 2 shared topics |
Home - Mini Dental Implants of KC | en | dental-healthWordPressWooCommerce | robotsllmsaihumans | emailphone | none |