| Domain | Match | Title | Country/Lang | Category | AI files | Contact | AI-protection |
|---|---|---|---|---|---|---|---|
| allpackagingmachinery.com ↗ | 74 match 2 shared topics |
All Packaging Machinery Inc. | en | manufacturing-industryJoomla | robotsllmsaihumans | emailphone | none |
| alliedpackagingmachinery.com ↗ | 73 match 2 shared topics |
Allied Packaging Machinery Ltd (APM) | en | manufacturing-industryWix | robotsllmsaihumans | emailphone | none |
| packmachinery-en.com ↗ | 73 match 2 shared topics |
Automatic Packaging Machines | Alpha-Pack | en | manufacturing-industry | robotsllmsaihumans | emailphone | none |
| shrinkmach.com ↗ | 73 match 2 shared topics |
Home - RYMACH Machinery | Shrink Film Packaging Machines | en | manufacturing-industryWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| packmachinefactory.com ↗ | 72 match 2 shared topics |
- WENZHOU LIANTENG PACKAGING MACHINERY CO .LTD | en | manufacturing-industry | robotsllmsaihumans | emailphone | none |
| acrepackaging.co.uk ↗ | 72 match 2 shared topics |
Packaging Supplies and Strapping Machines : Acre Packaging Supplies | United Kingdom en | manufacturing-industryWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| packagingtools.net ↗ | 72 match 2 shared topics |
Packaging Tools – Packaging Machines, Automation, Supplies | en | manufacturing-industryShopify | robotsllmsaihumans | emailphone | none |
| shrinksystem.com ↗ | 72 match 2 shared topics |
Industrial Packaging Machines - Industrial Packing Machines, Packaging Machines, Supplier | en | manufacturing-industry | robotsllmsaihumans | emailphone | none |
| packagingmachinerymanufacturer.com ↗ | 72 match 2 shared topics |
Packaging Machinery Manufacturer,face mask Automatic Packing Machine,flow wrapper packaging machine | en | manufacturing-industry | robotsllmsaihumans | emailphone | none |
| advanceddynamics.co.uk ↗ | 72 match 2 shared topics |
Advanced Dynamics - Packaging Machinery Solutions - UK | United Kingdom en | manufacturing-industryWordPress | robotsllmsaihumans | emailphone | none |
| packagingmachineryaffiliates.com ↗ | 71 match 2 shared topics |
Packaging Machinery Affiliates | en | manufacturing-industry | robotsllmsaihumans | emailphone | none |
| abcokovex.co.uk ↗ | 71 match 2 shared topics |
Abco Kovex - Packaging Materials and Machinery - Ireland | United Kingdom en | manufacturing-industryWordPress | robotsllmsaihumans | emailphone | none |
| shrivinayakmachine.com ↗ | 71 match 2 shared topics |
Fully Automatic Packaging Machines,Semi Automatic Packaging Machine Supplier,Manufacturer,Delhi | en | manufacturing-industry | robotsllmsaihumans | emailphone | none |
| dgxmachinery.com ↗ | 70 match 2 shared topics |
China Packaging Machine Manufacturer & Solution Provider - DGX Machinery | en | manufacturing-industryWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| packagingmachinesindia.com ↗ | 70 match 2 shared topics |
Unique Packaging Machines | en | manufacturing-industry | robotsllmsaihumans | emailphone | none |
| laserpackaging-st.com ↗ | 70 match 2 shared topics |
Industrial Packaging Machines - Feldman ST | en | manufacturing-industryWordPress | robotsllmsaihumans | emailphone | none |
| conpaptexequipments.com ↗ | 70 match 2 shared topics |
Textile Machinery, Spare, Parts, Flexible Packaging Machinery | en | manufacturing-industryWordPress | robotsllmsaihumans | emailphone | none |
| ozpackagingllc.com ↗ | 70 match 2 shared topics |
Packaging Solutions Experts | OZ Packaging | United States~ en | manufacturing-industry | robotsllmsaihumans | emailphone | none |