| Domain | Match | Title | Country/Lang | Category | AI files | Contact | AI-protection |
|---|---|---|---|---|---|---|---|
| divyashaktibuildcon.com ↗ | 70 match 2 shared topics |
Home - My Blog | en | construction-industryWordPress | robotsllmsaihumans | emailphone | none |
| kharakiagroup.com ↗ | 68 match 2 shared topics |
Welcome to KHARAKIA METALS Pvt. Ltd. | en | metals-industry | robotsllmsaihumans | emailphone | none |
| slroofing.com.my ↗ | 66 match 2 shared topics |
Home - SL Roofing Sdn. Bhd | en | construction-industryWordPress | robotsllmsaihumans | emailphone | none |
| theaksteels.com ↗ | 66 match 2 shared topics |
Home - AK Steels | en | metals-industryWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| millenniumsteel.net ↗ | 66 match 2 shared topics |
Home - Millennium Steel | en | construction-industryWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| bell-steel.com ↗ | 66 match 2 shared topics |
Home - Bell Steel Inc. | en | metals-industryWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| designco.net ↗ | 66 match 2 shared topics |
Home - Designco, Inc. | en | construction-industry | robotsllmsaihumans | emailphone | none |
| nasmafaris.com ↗ | 66 match 2 shared topics |
Home - Nasma Al Faris Contracting & Steel Fabrication | en | metals-industryWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| theuksteel.com ↗ | 65 match 2 shared topics |
Home - TheUkSteel | en | metals-industryWordPress | robotsllmsaihumans | emailphone | none |
| zimmermansteelpa.com ↗ | 65 match 2 shared topics |
Home - Zimmerman Steel | en | metals-industryWordPress | robotsllmsaihumans | emailphone | none |
| mehboobsteel.pk ↗ | 65 match 2 shared topics |
Home - Mehboob steel pipes| Best steel pipe supplier | en | metals-industryWordPress | robotsllmsaihumans | emailphone | none |
| algargllc.com ↗ | 65 match 2 shared topics |
Home - AL GARG Steel & Aluminium Tr.LLC | en | metals-industryWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| adamsiron.com ↗ | 65 match 2 shared topics |
Home - Adams Iron | en | construction-industryWordPress | robotsllmsaihumans | emailphone | none |
| thehafizgroups.com ↗ | 65 match 2 shared topics |
Home - thehafizgroups.com | en | construction-industryWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| ashapura.com ↗ | 65 match 2 shared topics |
Home | Ashapura | en | construction-industryWebflow | robotsllmsaihumans | emailphone | none |
| alhaddafalaqwiyarawmaterials.com ↗ | 65 match 2 shared topics |
Home - AL HADDAF AL AQWIYA TRADING OF MATERIALS AND RAW MATERIALS COMPANY - BFC | en | metals-industryWordPress | robotsllmsaihumans | emailphone | none |
| foundationsupply.net ↗ | 65 match 2 shared topics |
Home - Foundation Supply | en | construction-industryWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| acornaluminium.com ↗ | 65 match 2 shared topics |
Home - Acorn Aluminium | en | construction-industryWordPress | robotsllmsaihumans | emailphone | none |