| Domain | Match | Title | Country/Lang | Category | AI files | Contact | AI-protection |
|---|---|---|---|---|---|---|---|
| janesvillechimneyandfireplace.com ↗ | 78 match 1 shared topics |
Chimney Cleaning & Fireplace Services | Janesville | en | home-improvementSquarespaceMagento | robotsllmsaihumans | emailphone | none |
| jacobmasterservices.com ↗ | 74 match 1 shared topics |
Jacob Master Services | Chimney, Fireplace & Air Duct Experts | en | home-improvement | robotsllmsaihumans | emailphone | none |
| dimplexfireplaceservice.com ↗ | 72 match 1 shared topics |
Fireplace Services | en | home-improvement | robotsllmsaihumans | emailphone | none |
| tjacs.co ↗ | 72 match 1 shared topics |
J&D Cleaning and Services | Colombia en | home-improvement | robotsllmsaihumans | emailphone | none |
| jedcleaning.net ↗ | 72 match 1 shared topics |
J&D Cleaning and Services | United States~ en | home-improvement | robotsllmsaihumans | emailphone | none |
| garayhousekeeping.com ↗ | 72 match 1 shared topics |
Home | Garay Cleaning Services | The Greater Bay Area | en | home-improvement | robotsllmsaihumans | emailphone | none |
| garaycleaningservice.com ↗ | 72 match 1 shared topics |
Home | Garay Cleaning Services | The Greater Bay Area | en | home-improvement | robotsllmsaihumans | emailphone | none |
| jdscleaningservice.com ↗ | 72 match 1 shared topics |
JD's cleaning services | en | home-improvement | robotsllmsaihumans | emailphone | none |
| demmithexterior.com ↗ | 71 match 1 shared topics |
Air Duct, Dryer Vent & Exterior Cleaning | Demmith Exterior | United States~ en | home-improvement | robotsllmsaihumans | emailphone | none |
| sixpennychimneysweeps.net ↗ | 71 match 1 shared topics |
Sixpenny Chimney Sweeps | Fireplace and Wood Stove | Woodbridge, VA | en | home-improvement | robotsllmsaihumans | emailphone | none |
| 2ndgenerationchimneys.com ↗ | 71 match 1 shared topics |
Chimney and Fireplace Service Company Minneapolis | Professional Chimney Sweeping | en | home-improvement | robotsllmsaihumans | emailphone | none |
| marmirocare.com ↗ | 71 match 1 shared topics |
Marmiro Care, LLC | cleaning services | Home | en | home-improvement | robotsllmsaihumans | emailphone | none |
| sbmiraclecleaning.com ↗ | 71 match 1 shared topics |
SB Miracle Cleaning Services | en | home-improvement | robotsllmsaihumans | emailphone | none |
| weareacecore.com ↗ | 71 match 1 shared topics |
AceCore | Cleaning Services | en | home-improvementWix | robotsllmsaihumans | emailphone | none |
| 4abetterview.com ↗ | 71 match 1 shared topics |
Professional Window Cleaning Services | A Better View | United States~ en | home-improvementWordPress | robotsllmsaihumans | emailphone | none |
| 360touchcleaning.com ↗ | 71 match 1 shared topics |
360 Touch Cleaning Services | en | home-improvement | robotsllmsaihumans | emailphone | none |
| wedoawningcleaning.com ↗ | 71 match 1 shared topics |
Awning Cleaning Services | Awning Cleaning Service Near Me | en | home-improvementWordPress | robotsllmsaihumans | emailphone | none |
| boracleaningservices.com ↗ | 71 match 1 shared topics |
Home - Bora Cleaning Services | en | home-improvementWordPress | robotsllmsaihumans | emailphone | none |