| Domain | Match | Title | Country/Lang | Category | AI files | Contact | AI-protection |
|---|---|---|---|---|---|---|---|
| alistairmaine.com ↗ | 64 match 1 shared topics |
Alistair Maine Group | en | travel | robotsllmsaihumans | emailphone | none |
| helloexplorer.com ↗ | 63 match 1 shared topics |
Hello Explorer | Travels and Experiences | en | travel | robotsllmsaihumans | emailphone | none |
| crystalistatravels.com ↗ | 63 match 1 shared topics |
Home - Crystalista Travel | en | travelWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| theglocalistguides.com ↗ | 63 match 1 shared topics |
The Glocalist | en | travelSquarespace | robotsllmsaihumans | emailphone | none |
| themeaninglesslife.com ↗ | 63 match 1 shared topics |
Travel Blog - Journey, Stories and Experiences | en | travel | robotsllmsaihumans | emailphone | none |
| alisonbone.com ↗ | 63 match 1 shared topics |
Travel Media Specialist | en | travelWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| thelist-dubai.com ↗ | 63 match 1 shared topics |
Home Page - The List Dubai | en | travelWordPress | robotsllmsaihumans | emailphone | none |
| daishs.co.uk ↗ | 63 match 1 shared topics |
Daish's Holidays - UK Coach Holiday Specialists | United Kingdom en | travel | robotsllmsaihumans | emailphone | none |
| cocktailsndreamstravel.com ↗ | 63 match 1 shared topics |
Welcome to Cocktails N Dreams Travel | Canada~ en | travel | robotsllmsaihumans | emailphone | none |
| voiceguide.app ↗ | 63 match 1 shared topics |
VoiceGuide Travel App | en | travel | robotsllmsaihumans | emailphone | none |
| alistcoaches.com ↗ | 63 match 1 shared topics |
A List Coaches | en | travelSquarespaceMagento | robotsllmsaihumans | emailphone | none |
| luxury-experience-design.com ↗ | 63 match 1 shared topics |
Luxury Travel Experiences Designer | en | travel | robotsllmsaihumans | emailphone | none |
| roseparadeexperience.com ↗ | 63 match 1 shared topics |
2027 Tournament of Roses Parade Travel Packages | en | travel | robotsllmsaihumans | emailphone | none |
| luxtravelsmart.com ↗ | 63 match 1 shared topics |
Lux Travel Smart - Your Ultimate Guide to Luxury Travel Experiences | en | travelWordPressWooCommerce | robotsllmsaihumans | emailphone | partial · 8 |
| magicalkenyatravelspecialist.com ↗ | 63 match 1 shared topics |
Magical Kenya Travel Specialist Program | en | travel | robotsllmsaihumans | emailphone | none |
| themexicoconcierge.com ↗ | 63 match 1 shared topics |
Betty | The mexico concierge | en | travelWordPress | robotsllmsaihumans | emailphone | none |
| curvytravelista.com ↗ | 63 match 1 shared topics |
Curvy Travelista | en | travel | robotsllmsaihumans | emailphone | none |
| capitalhilltours.com ↗ | 63 match 1 shared topics |
Your ATX Tour | Private Austin Bronco Tours & Sightseeing. | en | travel | robotsllmsaihumans | emailphone | none |