| Domain | Match | Title | Country/Lang | Category | AI files | Contact | AI-protection |
|---|---|---|---|---|---|---|---|
| shrinksystem.com ↗ | 76 match 2 shared topics |
Industrial Packaging Machines - Industrial Packing Machines, Packaging Machines, Supplier | en | manufacturing-industry | robotsllmsaihumans | emailphone | none |
| allpackagingmachinery.com ↗ | 76 match 2 shared topics |
All Packaging Machinery Inc. | en | manufacturing-industryJoomla | robotsllmsaihumans | emailphone | none |
| packagingmachinesindia.com ↗ | 73 match 2 shared topics |
Unique Packaging Machines | en | manufacturing-industry | robotsllmsaihumans | emailphone | none |
| alliedpackagingmachinery.com ↗ | 73 match 2 shared topics |
Allied Packaging Machinery Ltd (APM) | en | manufacturing-industryWix | robotsllmsaihumans | emailphone | none |
| packpropackaging.net ↗ | 73 match 2 shared topics |
Packpro Packaging Industries, Dombivli - Tube Filling Machine and Filling Machines | India~ en | manufacturing-industry | robotsllmsaihumans | emailphone | none |
| packmachinery-en.com ↗ | 73 match 2 shared topics |
Automatic Packaging Machines | Alpha-Pack | en | manufacturing-industry | robotsllmsaihumans | emailphone | none |
| pail-plastic.net ↗ | 73 match 2 shared topics |
Industrial Packaging Solutions | Mauser Packaging | en | mechanical-and-industrial-engineering-industryWordPress | robotsllmsaihumans | emailphone | none |
| pail-plastic.com ↗ | 73 match 2 shared topics |
Industrial Packaging Solutions | Mauser Packaging | en | mechanical-and-industrial-engineering-industryWordPress | robotsllmsaihumans | emailphone | none |
| conpaptexequipments.com ↗ | 73 match 2 shared topics |
Textile Machinery, Spare, Parts, Flexible Packaging Machinery | en | manufacturing-industryWordPress | robotsllmsaihumans | emailphone | none |
| dg-sdk.com ↗ | 72 match 2 shared topics |
DGSDK | Static Eliminators & Industrial Cleaning Machines | China~ en | manufacturing-industrySpree Commerce | robotsllmsaihumans | emailphone | none |
| vkmachineries.com ↗ | 72 match 2 shared topics |
Veerakumar Industrial Machineries | en | mechanical-and-industrial-engineering-industry | robotsllmsaihumans | emailphone | none |
| growpack.co ↗ | 72 match 2 shared topics |
GrowPack | Industrial Packaging Solutions | Colombia en | manufacturing-industry | robotsllmsaihumans | emailphone | none |
| advanceddynamics.co.uk ↗ | 72 match 2 shared topics |
Advanced Dynamics - Packaging Machinery Solutions - UK | United Kingdom en | manufacturing-industryWordPress | robotsllmsaihumans | emailphone | none |
| 3corepack.com ↗ | 72 match 2 shared topics |
Industrial Packaging Engineering & Manufacturing Mexico | 3CorePack | en | mechanical-and-industrial-engineering-industry | robotsllmsaihumans | emailphone | none |
| packagingtools.net ↗ | 71 match 2 shared topics |
Packaging Tools – Packaging Machines, Automation, Supplies | en | manufacturing-industryShopify | robotsllmsaihumans | emailphone | none |
| packagingmachineryaffiliates.com ↗ | 71 match 2 shared topics |
Packaging Machinery Affiliates | en | manufacturing-industry | robotsllmsaihumans | emailphone | none |
| dhoopmachinemanufacture.com ↗ | 71 match 2 shared topics |
VS Engineers - Manufacturer of Industrial Machinery. | en | mechanical-and-industrial-engineering-industryWordPress | robotsllmsaihumans | emailphone | none |
| abcokovex.co.uk ↗ | 71 match 2 shared topics |
Abco Kovex - Packaging Materials and Machinery - Ireland | United Kingdom en | manufacturing-industryWordPress | robotsllmsaihumans | emailphone | none |