similar sites

Browse

Pricing AI Report

Tools

🚀Submit Your Site to AIPush your URL to AI search engines 🛰️AI Bot ObservatoryEvery AI crawler & who blocks it 📇AI Crawler Database900+ AI user agents + robots.txt gen ⚖️AI Crawler ComparisonCompare two AI crawlers head-to-head 💰AI Licensing / Pay-Per-CrawlWho can charge AI crawlers — Pay-Per-Crawl 🎛️AI Robots.txt Policy BuilderGoal-based robots.txt (cite me, don't train)🤖AI Crawler CheckerSee which AI bots your site blocks 🎯AI Readiness CheckerScore your site 0–100 for AI 🔗Backlink CheckerWho links to any site — free All tools →

Browse free →

Sites similar to kinderwall.com

Kinderwall alternatives & similar sites

Kinderwall - Blog de educación infantil — 18 websites ranked by shared content topics, category and on-page relevance.

Each result shows its full tech stack, contacts and AI-policy — not just a name · Browse all sites in Early Childhood Education →

Domain	Match	Title	Country/Lang	Category	AI files	Contact	AI-protection
actividadeseducainfantil.com ↗	72 match 1 shared topics	Actividades para Educación Infantil	es	early-childhood-education	robotsllmsaihumans	emailphone	none
minigenios.org ↗	70 match 1 shared topics	Mini Genios - Educación Divertida	es	early-childhood-education	robotsllmsaihumans	emailphone	none
actividadesdeinfantil.com ↗	70 match 1 shared topics	ACTIVIDADES DE EDUCACIÓN INFANTIL – Recursos e ideas sencillas y divertidas para Educación Infantil. Para aprender jugando en tu aula o en tu casa	es	early-childhood-education WordPress	robotsllmsaihumans	emailphone	none
kicklinkacademy.com ↗	70 match 1 shared topics	KickLink Academy — Centro de Formación Infantil	es	early-childhood-education	robotsllmsaihumans	email phone	none
kidencia.com ↗	68 match 1 shared topics	KIDENCIA (MR) \| Centro Integral de Educación para la Vida Real	es	early-childhood-education	robotsllmsaihumans	emailphone	none
actividadesdeinfantilyprimaria.com ↗	67 match 1 shared topics	Actividades de infantil y primaria - Recursos para trabajar en infantil y primaria	es	early-childhood-education WordPress	robotsllmsaihumans	emailphone	none
activityclass.com ↗	66 match 1 shared topics	Programas educativos - Aula integral de Formación	es	early-childhood-education WordPress	robotsllmsaihumans	emailphone	none
acaech.org ↗	66 match 1 shared topics	Asociación de Apoyo y Educación en Chiapas A.C.	es	early-childhood-education WordPress	robots llmsaihumans	email phone	none
mynurserymanager.com ↗	66 match 1 shared topics	Agenda Digital Infantil para Escuelas y Guarderías - App	es	early-childhood-education	robotsllmsaihumans	email phone	none
kidhouseplay.com ↗	66 match 1 shared topics	Parque infantil Bogotá - Kid House Play	es	early-childhood-education WordPress WooCommerce	robotsllmsaihumans	emailphone	none
familylifehomeschooling.com ↗	65 match 1 shared topics	\| BLOG ENFOCADO A FAMILIAS QUE DECIDEN EDUCAR A SUS HIJOS EN CASA	es	early-childhood-education WordPress	robotsllmsaihumans	emailphone	none
neoasociacion.org ↗	65 match 1 shared topics	Asociación NEO - Asociación NEO	es	early-childhood-education WordPress WooCommerce	robotsllmsaihumans	emailphone	none
zonadeninos11.com ↗	64 match 1 shared topics	Zona de NIños: nunca fue tan divertido aprender – Red de apoyo educativo	es	early-childhood-education WordPress	robotsllmsaihumans	emailphone	none
mismaterialeseducativos.com ↗	64 match 1 shared topics	Mis Materiales Educativos	es	early-childhood-education	robotsllmsaihumans	emailphone	none
bebegenialschool.com ↗	64 match 1 shared topics	Bebé Genial School \| Entiende, Innova y Educa Hoy	es	early-childhood-education Squarespace Magento	robotsllmsaihumans	emailphone	none
bebegenial.com ↗	64 match 1 shared topics	Bebé Genial Colombia \| estimulación temprana \| Bebé Políglota	es	early-childhood-education WordPress WooCommerce	robotsllmsaihumans	emailphone	none
reinosletrimagia.com ↗	64 match 1 shared topics	Reinos de Letrimagia – Donde la imaginación y la creatividad, son infinitas	es	early-childhood-education WordPress WooCommerce	robotsllmsaihumans	emailphone	none
actividadesparapreescolar.net ↗	63 match 1 shared topics	Actividades Para Preescolar - Mas de 1000 Fichas para Imprimir 2026	es	early-childhood-education WordPress	robotsllmsaihumans	emailphone	none

How the match score works

Each match is a 0–100 similarity score — the higher it is, the more two sites resemble one another. It’s computed automatically from our own crawl data (never from what a site says about itself) by combining several independent signals, so a high score means several of them point the same way:

shared topics how many of the same fine‑grained content topics (IAB sub‑categories) both sites cover — the main signal.
same category whether they sit in the same business / industry category.
content & title how closely their titles and page descriptions line up in wording and meaning.

No single signal decides the result — they’re blended together. Treat the score as a way to rank candidates rather than an absolute percentage; the chips on each result show which signals contributed.