| Domain | Match | Title | Country/Lang | Category | AI files | Contact | AI-protection |
|---|---|---|---|---|---|---|---|
| breezedonormatch.com ↗ | 69 match 1 shared topics |
BREEZE DonorMatch | en | medical-healthWordPress | robotsllmsaihumans | emailphone | none |
| breezehomehealthcarellc.com ↗ | 66 match 1 shared topics |
Breeze Home Healthcare LLC | United States~ en | medical-healthWordPress | robotsllmsaihumans | emailphone | none |
| breezehealthandwellness.com ↗ | 66 match 1 shared topics |
Home | Breeze Health And We | en | medical-healthWix | robotsllmsaihumans | emailphone | none |
| breezemedurgentcare.com ↗ | 64 match 1 shared topics |
BreezeMed Urgent Care | Naples, FL | United States~ en | medical-health | robotsllmsaihumans | emailphone | none |
| 1nhealth-visitplanner.com ↗ | 62 match 1 shared topics |
1nHealth Visit Planner | en | medical-health | robotsllmsaihumans | emailphone | none |
| breezeuc.com ↗ | 62 match 1 shared topics |
Texas Health Breeze Urgent Care | Texas Health Breeze Urgent Care | en | medical-health | robotsllmsaihumans | emailphone | none |
| breezeurgentcare.com ↗ | 62 match 1 shared topics |
Texas Health Breeze Urgent Care | Texas Health Breeze Urgent Care | en | medical-health | robotsllmsaihumans | emailphone | none |
| breezeoflifehpc.com ↗ | 62 match 1 shared topics |
Breeze of life Hospice and Palliative Care – Embracing comfort | en | medical-healthWordPress | robotsllmsaihumans | emailphone | none |
| breezehospiceservices.com ↗ | 62 match 1 shared topics |
Care, Compassion, Dignity | Breeze Hospice MO - Breeze Hospice Services | United States~ en | medical-healthWordPress | robotsllmsaihumans | emailphone | none |
| janemattsonassociates.com ↗ | 61 match 1 shared topics |
Our Practice – Empirical Planners | en | medical-healthWordPress | robotsllmsaihumans | emailphone | none |
| breevo.com ↗ | 61 match 1 shared topics |
Breevo | Canada’s Trusted CPAP Retailer: Masks, Machines & More | en | medical-healthShopify | robotsllmsaihumans | emailphone | none |
| breeoot.com ↗ | 61 match 1 shared topics |
Breeoot — Precision Preventive Medicine for High-Performing Individuals | en | medical-health | robotsllmsaihumans | emailphone | none |
| qual-p.org ↗ | 60 match 1 shared topics |
Qual-P – Improving the quality of prison healthcare and planning for recovery from Covid-19 | en | medical-healthWordPress | robotsllmsaihumans | emailphone | none |
| blackdoctor.pro ↗ | 60 match 1 shared topics |
Black Doctors Health Articles and Clinical Trials | BDO Pro | en | medical-healthWordPress | robotsllmsaihumans | emailphone | none |
| blackhillsfamilypracticeandwellness.com ↗ | 60 match 1 shared topics |
Independently Owned Family Medical Practice And Wellness | en | medical-healthWordPress | robotsllmsaihumans | emailphone | none |
| blackmeninwhitecoats.org ↗ | 60 match 1 shared topics |
Let's increase the number of black men in medicine - Black Men in White Coats | en | medical-healthWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| blacknursesrockdelawarechapter.com ↗ | 60 match 1 shared topics |
www.blacknurserockdelawarechapter,Inc.com | black nurses organization | en | medical-healthWix | robotsllmsaihumans | emailphone | none |
| blacksmithsfamilymedicalpractice.com ↗ | 60 match 1 shared topics |
Home | Blacksmithsfamilymed | en | medical-healthWix | robotsllmsaihumans | emailphone | none |