| Domain | Match | Title | Country/Lang | Category | AI files | Contact | AI-protection |
|---|---|---|---|---|---|---|---|
| 4seasonlawncare.com ↗ | 77 match 2 shared topics |
Lawn Care & Landscaping Services | 4 Seasons Lawn Care | United States~ en | landscaping | robotsllmsaihumans | emailphone | none |
| friendlylandscapesgbg.com ↗ | 76 match 2 shared topics |
Friendly Landscapes – Lawn Care & Landscaping in Greensburg, PA | en | landscaping | robotsllmsaihumans | emailphone | none |
| zorooutdoorsolutions.com ↗ | 76 match 2 shared topics |
Douglas & Cobb County Lawn Care & Landscaping | ZORO | en | landscapingWordPress | robotsllmsaihumans | emailphone | none |
| mcclungslandscaping.com ↗ | 75 match 2 shared topics |
McClung's Landscaping | Lawn Care & Hardscaping in Page County, VA | United States~ en | landscaping | robotsllmsaihumans | emailphone | none |
| rescuelawncare.com ↗ | 75 match 2 shared topics |
Lawn Care & Landscaping in Wake Forest | Rescue Lawn Care | en | landscapingWordPress | robotsllmsaihumans | emailphone | none |
| melilloslawncareandlandscaping.com ↗ | 75 match 2 shared topics |
MELILLO'S Lawn Care and Landscaping Inc.: Lawn Care & Landscaping Services | en | landscaping | robotsllmsaihumans | emailphone | none |
| donslawncarellc.com ↗ | 75 match 2 shared topics |
South County RI Lawn Care & Landscaping | Don’s Lawn Care | en | landscapingWeebly | robotsllmsaihumans | emailphone | none |
| 5starlawncare.net ↗ | 75 match 2 shared topics |
5 Star Lawn Care & Landscaping | Lawn Care & Supply Center in Northeast Ohio | en | landscapingSquarespaceMagento | robotsllmsaihumans | emailphone | none |
| landscapecompanycherryhillnj.com ↗ | 75 match 2 shared topics |
Frank’s Lawn Services | Lawn Care & Landscaping in Audubon, NJ | en | landscaping | robotsllmsaihumans | emailphone | none |
| frankslawnandhandymanservice.com ↗ | 75 match 2 shared topics |
Frank’s Lawn Services | Lawn Care & Landscaping in Audubon, NJ | en | landscaping | robotsllmsaihumans | emailphone | none |
| melissalandscaping.com ↗ | 75 match 2 shared topics |
TruScape Lawn Care & Landscaping Services in North Texas | United States~ en | landscapingWordPress | robotsllmsaihumans | emailphone | none |
| 3warriorslandscape.com ↗ | 75 match 2 shared topics |
3 Warriors Lawn Care & Landscape LLC | Landscaping in Olympia, WA | en | landscaping | robotsllmsaihumans | emailphone | none |
| givinghopelawn.com ↗ | 75 match 2 shared topics |
Giving Hope Lawn Management | Lawn Care & Landscaping | United States~ en | landscapingWordPress | robotsllmsaihumans | emailphone | none |
| myhappylawns.com ↗ | 74 match 2 shared topics |
Happy Lawns: Lawn Care & Landscaping Services Berks County, PA | en | landscaping | robotsllmsaihumans | emailphone | none |
| warnocklandscaping.com ↗ | 74 match 2 shared topics |
Warnock's Lawn Care & Landscaping - Gaston County | en | landscapingWordPress | robotsllmsaihumans | emailphone | none |
| belezalawn.com ↗ | 74 match 2 shared topics |
Beleza Lawn Care: expert lawn care and landscaping in Brevard County, Florida | en | landscaping | robotsllmsaihumans | emailphone | none |
| keanelandscape.com ↗ | 74 match 2 shared topics |
Keane Landscaping | Lawn Care & Landscaping | en | landscaping | robotsllmsaihumans | emailphone | none |
| mooselawnandlandscape.com ↗ | 74 match 2 shared topics |
Lawn Care & Landscaping Services in Goldsboro, NC | Moose Lawncare | United States~ en | landscaping | robotsllmsaihumans | emailphone | none |