| Domain | Match | Title | Country/Lang | Category | AI files | Contact | AI-protection |
|---|---|---|---|---|---|---|---|
| singaporelanavapecod.com ↗ | 75 match 1 shared topics |
Lana Vape Singapore | Best SG Vape Shop & Same Day Delivery – SingaporeLanaVapeCod | en | illegal-drugs-tobacco-ecigarettes-vaping-alcoholShopify | robotsllmsaihumans | emailphone | none |
| myusavape.com ↗ | 69 match 1 shared topics |
USA Vape | Smoke Shop Delivery in Florida – Vapes, Cigars & More | en | illegal-drugs-tobacco-ecigarettes-vaping-alcohol | robotsllmsaihumans | emailphone | none |
| singaporevapedeliveryshopsss.com ↗ | 69 match 1 shared topics |
SG Vape Co | Singapore Online Store – Singapore Vape Delivery Shop | en | illegal-drugs-tobacco-ecigarettes-vaping-alcoholShopify | robotsllmsaihumans | emailphone | none |
| foggfather.co.uk ↗ | 69 match 1 shared topics |
Fogg Father UK Vape Shop - NEXT DAY DELIVERY | United Kingdom en | illegal-drugs-tobacco-ecigarettes-vaping-alcohol | robotsllmsaihumans | emailphone | partial · 8 |
| foggfather.com ↗ | 69 match 1 shared topics |
Fogg Father UK Vape Shop - NEXT DAY DELIVERY | en | illegal-drugs-tobacco-ecigarettes-vaping-alcohol | robotsllmsaihumans | emailphone | partial · 8 |
| flawlessvapeshop.co.uk ↗ | 68 match 1 shared topics |
Flawless Vape Shop – UK's #1 Online Vape Store | Free Delivery | United Kingdom en | illegal-drugs-tobacco-ecigarettes-vaping-alcoholShopify | robotsllmsaihumans | emailphone | none |
| iamreneejones.com ↗ | 68 match 1 shared topics |
Elf Bar Vape: Mystical ElfBar Vaping Experience | en | illegal-drugs-tobacco-ecigarettes-vaping-alcoholWordPressWooCommerce | robotsllmsaihumans | emailphone | partial · 8 |
| katycannaclub.com ↗ | 68 match 1 shared topics |
Katy Dispensary - Same Day Delivery | Katy Cannabis Club | en | illegal-drugs-tobacco-ecigarettes-vaping-alcoholShopify | robotsllmsaihumans | emailphone | none |
| mangovape.ca ↗ | 68 match 1 shared topics |
Mango Vapes | Same-Day Local Delivery | Ottawa | Canada en | illegal-drugs-tobacco-ecigarettes-vaping-alcoholShopify | robotsllmsaihumans | emailphone | none |
| mangovapes.ca ↗ | 68 match 1 shared topics |
Mango Vapes | Same-Day Local Delivery | Ottawa | Canada en | illegal-drugs-tobacco-ecigarettes-vaping-alcoholShopify | robotsllmsaihumans | emailphone | none |
| gosmokefree.co.uk ↗ | 68 match 1 shared topics |
Vape UK | UK's Cheapest Online Vape Shop | FREE Next Day Delivery | United Kingdom en | illegal-drugs-tobacco-ecigarettes-vaping-alcoholBigCommerce | robotsllmsaihumans | emailphone | none |
| cypresscannaclub.com ↗ | 68 match 1 shared topics |
Cypress Dispensary - Same Day Delivery | Cypress Cannabis Club | en | illegal-drugs-tobacco-ecigarettes-vaping-alcoholShopify | robotsllmsaihumans | emailphone | none |
| e-liquidshop.co.uk ↗ | 68 match 1 shared topics |
Vape Shop Online UK: FREE Delivery – The Puffin Hut | United Kingdom en | illegal-drugs-tobacco-ecigarettes-vaping-alcoholShopify | robotsllmsaihumans | emailphone | none |
| eliquid-shop.co.uk ↗ | 68 match 1 shared topics |
Vape Shop Online UK: FREE Delivery – The Puffin Hut | United Kingdom en | illegal-drugs-tobacco-ecigarettes-vaping-alcoholShopify | robotsllmsaihumans | emailphone | none |
| elfbar.co.uk ↗ | 68 match 1 shared topics |
ELFBAR UK - Official Elf Bar Online Vape Store | United Kingdom en | illegal-drugs-tobacco-ecigarettes-vaping-alcoholMagento | robotsllmsaihumans | emailphone | none |
| zvape.com ↗ | 68 match 1 shared topics |
ZVape - New England's #1 Online Vape Shop, Next Day Delivery! | en | illegal-drugs-tobacco-ecigarettes-vaping-alcoholWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| leafweeddispensaryweeddelivery.com ↗ | 67 match 1 shared topics |
Same Day Weed Delivery | Zen Garden | en | illegal-drugs-tobacco-ecigarettes-vaping-alcoholWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| gorilla-cannabis-seeds.co.uk ↗ | 67 match 1 shared topics |
Cannabis Seeds UK Next Day Delivery | Gorilla Seeds | United Kingdom en | illegal-drugs-tobacco-ecigarettes-vaping-alcoholMagento | robotsllmsaihumans | emailphone | none |