similar sites

Browse

Pricing AI Report

Tools

🚀Submit Your Site to AIPush your URL to AI search engines 🛰️AI Bot ObservatoryEvery AI crawler & who blocks it 🤖AI Crawler CheckerSee which AI bots your site blocks 🎯AI Readiness CheckerScore your site 0–100 for AI 🔗Backlink CheckerWho links to any site — free All tools →

Browse free →

Sites similar to eijen.com

Eijen alternatives & similar sites

FormuLens – Engineered Eyecare — 18 websites ranked by shared content topics, category and on-page relevance.

Each result shows its full tech stack, contacts and AI-policy — not just a name · Browse all sites in Eye And Vision Conditions →

Domain	Match	Title	Country/Lang	Category	AI files	Contact	AI-protection
northpointeyecare.com.au ↗	67 match 1 shared topics	Home – Northpoint Eyecare	Australia en	eye-and-vision-conditions WordPress	robotsllmsaihumans	email phone	none
richardwardeyecare.com ↗	66 match 1 shared topics	Richard Ward Eyecare	en	eye-and-vision-conditions WordPress	robotsllmsaihumans	emailphone	none
riverbendeye.com ↗	66 match 1 shared topics	Riverbend Eyecare – of Bend Oregon	en	eye-and-vision-conditions WordPress	robotsllmsaihumans	email phone	none
krzyzakeyecare.com ↗	66 match 1 shared topics	Krzyzak Eyecare	United States~ en	eye-and-vision-conditions WordPress WooCommerce	robotsllmsaihumans	emailphone	none
questfactor.net ↗	66 match 1 shared topics	Quest Factor LLC – EyeCare Medical Devices	en	eye-and-vision-conditions WordPress WooCommerce	robotsllmsaihumans	email phone	none
thebendereyecare.com ↗	66 match 1 shared topics	The Bender Eyecare	United States~ en	eye-and-vision-conditions WordPress	robotsllmsaihumans	emailphone	none
kurataeyecare.com ↗	65 match 1 shared topics	Kurata Eyecare Center	United States~ en	eye-and-vision-conditions Weebly	robotsllmsaihumans	emailphone	none
rockfordeyecare.com ↗	65 match 1 shared topics	Rockford Family Eyecare	en	eye-and-vision-conditions	robotsllmsaihumans	emailphone	none
truevisionik.com ↗	65 match 1 shared topics	TrueVision Eyecare Online	en	eye-and-vision-conditions	robotsllmsaihumans	emailphone	none
opticentre.com.au ↗	65 match 1 shared topics	George and Matilda Eyecare	Australia en	eye-and-vision-conditions	robotsllmsaihumans	emailphone	none
clearchoiceeyecare.biz ↗	65 match 1 shared topics	Clear Choice Eyecare - Home	en	eye-and-vision-conditions Weebly	robotsllmsaihumans	emailphone	none
downeyeye.com ↗	65 match 1 shared topics	Downey Eyecare Center – Family Vision & Eye Care	en	eye-and-vision-conditions	robotsllmsaihumans	emailphone	none
ringanalytics.ai ↗	65 match 1 shared topics	Ring Analytics by EyeCarePro	en	eye-and-vision-conditions	robotsllmsaihumans	emailphone	none
delawarevalleyfamilyeyecare.info ↗	64 match 1 shared topics	Delaware Valley Family Eyecare	United States~ en	eye-and-vision-conditions Weebly	robotsllmsaihumans	emailphone	none
mcnelisfamilyeyecare.net ↗	64 match 1 shared topics	McNelis Family Eyecare - Home	en	eye-and-vision-conditions Weebly	robotsllmsaihumans	emailphone	none
mcloughlineyecare.net ↗	64 match 1 shared topics	MCLOUGHLIN FAMILY EYECARE - Home	United States~ en	eye-and-vision-conditions Weebly	robotsllmsaihumans	email phone	none
trusted-eyecare.com ↗	64 match 1 shared topics	Trusted Eye Care LLC	United States~ en	eye-and-vision-conditions Squarespace Magento	robotsllmsaihumans	emailphone	none
a-zeyecare.com ↗	64 match 1 shared topics	A to Z Eyecare – Optometrist & Specialty Contact Lenses Professional	en	eye-and-vision-conditions WordPress	robotsllmsaihumans	emailphone	none

How the match score works

Each match is a 0–100 similarity score — the higher it is, the more two sites resemble one another. It’s computed automatically from our own crawl data (never from what a site says about itself) by combining several independent signals, so a high score means several of them point the same way:

shared topics how many of the same fine‑grained content topics (IAB sub‑categories) both sites cover — the main signal.
same category whether they sit in the same business / industry category.
content & title how closely their titles and page descriptions line up in wording and meaning.

No single signal decides the result — they’re blended together. Treat the score as a way to rank candidates rather than an absolute percentage; the chips on each result show which signals contributed.