| Domain | Match | Title | Country/Lang | Category | AI files | Contact | AI-protection |
|---|---|---|---|---|---|---|---|
| painfreepetsandpeople.com ↗ | 74 match 1 shared topics |
Home Page | en | veterinary-medicine | robotsllmsaihumans | emailphone | none |
| ladyvetanimalhospital.com ↗ | 72 match 1 shared topics |
Home Page | en | veterinary-medicineWeebly | robotsllmsaihumans | emailphone | none |
| ashcroftvets.org.uk ↗ | 72 match 1 shared topics |
Home Page | United Kingdom en | veterinary-medicine | robotsllmsaihumans | emailphone | partial · 14 |
| mccroryanimalclinicalbertville.com ↗ | 70 match 1 shared topics |
Welcome | United States~ en | veterinary-medicineDotNetNuke/DNN | robotsllmsaihumans | emailphone | none |
| bayanimal.com ↗ | 70 match 1 shared topics |
Welcome | United States~ en | veterinary-medicineDotNetNuke/DNN | robotsllmsaihumans | emailphone | none |
| arunvetgroup.co.uk ↗ | 66 match 1 shared topics |
Welcome - Arun Veterinary Group | United Kingdom en | veterinary-medicineWordPress | robotsllmsaihumans | emailphone | none |
| eternityanimalhealth.com ↗ | 66 match 1 shared topics |
Welcome - Eternity Animal Healthcare | en | veterinary-medicineWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| lambertvillevetclinic.com ↗ | 66 match 1 shared topics |
Welcome to Lambertville Veterinary Clinic in Lambertville, MI | en | veterinary-medicineWordPressWooCommerce | robotsllmsaihumans | emailphone | partial · 4 |
| overlandparkveterinaryspecialists.com ↗ | 66 match 1 shared topics |
Home Page | Overland Park Veterinary Emergency and Specialty | en | veterinary-medicine | robotsllmsaihumans | emailphone | none |
| heritageanimalh.com ↗ | 66 match 1 shared topics |
Welcome to Heritage Animal Hospital in Fontana, CA | en | veterinary-medicineWordPressWooCommerce | robotsllmsaihumans | emailphone | partial · 4 |
| heritageanimalhosp.com ↗ | 66 match 1 shared topics |
Welcome to Heritage Animal Hospital in Fontana, CA | en | veterinary-medicineWordPressWooCommerce | robotsllmsaihumans | emailphone | partial · 4 |
| mcclellanvet.com ↗ | 65 match 1 shared topics |
Welcome | Frederick, MD | McClellan Veterinary Clinic | en | veterinary-medicine | robotsllmsaihumans | emailphone | partial · 4 |
| ardenhousevets.co.uk ↗ | 65 match 1 shared topics |
Welcome To Arden House Animal Hospital : Arden House Animal Hospita | United Kingdom en | veterinary-medicine | robotsllmsaihumans | emailphone | none |
| vmcfolsom.com ↗ | 65 match 1 shared topics |
Welcome to Veterinary Medical Center in Folsom, CA 95630 | United States~ en | veterinary-medicineWordPressWooCommerce | robotsllmsaihumans | emailphone | partial · 4 |
| pacificcreekveterinaryservice.com ↗ | 64 match 1 shared topics |
Home Page - Pacific Creek Veterinary Service | en | veterinary-medicineWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| devonianveterinaryclinic.com ↗ | 64 match 1 shared topics |
Welcome to Your local Animal Hospital in Devon, Alberta | en | veterinary-medicineWordPressWooCommerce | robotsllmsaihumans | emailphone | partial · 4 |
| lakestreetvet.net ↗ | 64 match 1 shared topics |
Homepage | Lake Street Veterinary Clinic | en | veterinary-medicine | robotsllmsaihumans | emailphone | none |
| 4rsvp.com ↗ | 64 match 1 shared topics |
HomePage - RELIEF VETS | United States~ en | veterinary-medicineWordPress | robotsllmsaihumans | emailphone | none |