| Domain | Match | Title | Country/Lang | Category | AI files | Contact | AI-protection |
|---|---|---|---|---|---|---|---|
| 247plumbingcompany.com ↗ | 66 match 1 shared topics |
Plumbing | | | en | home-improvement | robotsllmsaihumans | emailphone | none |
| larkin-hvac.com ↗ | 64 match 1 shared topics |
Heating | Cooling | & Anything Air | en | home-improvementWordPress | robotsllmsaihumans | emailphone | none |
| csiplumbing.com ↗ | 63 match 1 shared topics |
CSI Plumbing | Midlothian, Texas | United States~ en | home-improvementWordPress | robotsllmsaihumans | emailphone | none |
| outlawfamilyfencing.com ↗ | 63 match 1 shared topics |
Outlaw Family Fencing | Austin, TX | en | home-improvement | robotsllmsaihumans | emailphone | none |
| bcleangroup.com ↗ | 63 match 1 shared topics |
Exterior House Cleaning | B CLEAN | en | home-improvementWix | robotsllmsaihumans | emailphone | none |
| all-outplumbing.com ↗ | 63 match 1 shared topics |
All-Out Plumbing, LLC | Plumbing | Chesilhurst, NJ | en | home-improvement | robotsllmsaihumans | emailphone | none |
| acplumbingheating.co.uk ↗ | 63 match 1 shared topics |
AC Plumbing and Heating | Bathrooms | Central Heating | United Kingdom en | home-improvement | robotsllmsaihumans | emailphone | none |
| alexscarpetcleaningnc.com ↗ | 63 match 1 shared topics |
Alex’s Carpet Cleaning | Carpet Cleaning in Charlotte | United States~ en | home-improvementLightspeed | robotsllmsaihumans | emailphone | none |
| abcwindowcleaning.co.uk ↗ | 63 match 1 shared topics |
ABC Window Cleaning | | United Kingdom en | home-improvementDrupal | robotsllmsaihumans | emailphone | none |
| oviedocarpetcleaningservice.com ↗ | 63 match 1 shared topics |
Oviedo Carpet Cleaning | (407) 440-0934 | en | home-improvement | robotsllmsaihumans | emailphone | none |
| oxnardinsulationcontractors.com ↗ | 63 match 1 shared topics |
The King of Insulation | en | home-improvement | robotsllmsaihumans | emailphone | none |
| mckinneyhomeplumbing.com ↗ | 63 match 1 shared topics |
McKinney Home Plumbing | Licensed Plumbers in McKinney, TX | en | home-improvement | robotsllmsaihumans | emailphone | none |
| dhesiplumbing.com ↗ | 63 match 1 shared topics |
Dhesi Plumbing | Best Plumbing Services | en | home-improvementWordPress | robotsllmsaihumans | emailphone | none |
| monteirocleaningservices.com ↗ | 63 match 1 shared topics |
Monteiro Cleaning | Cleaning Services in PA, NJ & Delaware | en | home-improvementWordPress | robotsllmsaihumans | emailphone | none |
| lakemarycarpetcleaningservice.com ↗ | 63 match 1 shared topics |
Lake Mary Carpet Cleaning | (407) 440-0901 | en | home-improvement | robotsllmsaihumans | emailphone | none |
| allbritewindows.com ↗ | 63 match 1 shared topics |
All Brite Window Cleaning | South Florida | United States~ en | home-improvement | robotsllmsaihumans | emailphone | none |
| dgcustomsprayfoaming.com ↗ | 63 match 1 shared topics |
D&G Custom Spray Foaming | Gallipolis, OH | en | home-improvement | robotsllmsaihumans | emailphone | none |
| acereflections.co.uk ↗ | 63 match 1 shared topics |
Ace Reflections Window Cleaning | Wareham Cleaning Services | United Kingdom en | home-improvementLightspeed | robotsllmsaihumans | emailphone | none |