| Domain | Match | Title | Country/Lang | Category | AI files | Contact | AI-protection |
|---|---|---|---|---|---|---|---|
| densmorefireplaces.com ↗ | 70 match 1 shared topics |
Gas fireplace upgrades, service, and repairs made easy. | en | home-improvement | robotsllmsaihumans | emailphone | none |
| janesvillechimneyandfireplace.com ↗ | 69 match 1 shared topics |
Chimney Cleaning & Fireplace Services | Janesville | en | home-improvementSquarespaceMagento | robotsllmsaihumans | emailphone | none |
| 247toiletrepair.com ↗ | 69 match 1 shared topics |
Expert Toilet Repair and Replacement Services in Chicago | Toilet Fixer | en | home-improvement | robotsllmsaihumans | emailphone | none |
| 1stchoicemovinglaborandlogistics.com ↗ | 68 match 1 shared topics |
Property Upkeep Services - 1st Choice | en | home-improvementWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| jacobmasterservices.com ↗ | 68 match 1 shared topics |
Jacob Master Services | Chimney, Fireplace & Air Duct Experts | en | home-improvement | robotsllmsaihumans | emailphone | none |
| 247garagedoorservices.com ↗ | 68 match 1 shared topics |
24/7 Garage Door Services and Repair Rockwall | en | home-improvement | robotsllmsaihumans | emailphone | none |
| boomwindowcompany.com ↗ | 68 match 1 shared topics |
Window repair and screen replacement service | United States~ en | home-improvement | robotsllmsaihumans | emailphone | none |
| adv-svs.com ↗ | 68 match 1 shared topics |
Advanced Services Kuwait For HVAC | Air Conditioner Repairs and Services | en | home-improvementWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| watolbard.com ↗ | 68 match 1 shared topics |
Gas Fireplace Installation & Repair in Frederick MD | W.A. Tolbard | en | home-improvementWordPress | robotsllmsaihumans | emailphone | none |
| ovhdoor.com ↗ | 68 match 1 shared topics |
Garage Door Service in Houston | Repairs and Replacements | en | home-improvementWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| ovhdoors.com ↗ | 68 match 1 shared topics |
Garage Door Service in Houston | Repairs and Replacements | en | home-improvementWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| boncogaragedoors.com ↗ | 67 match 1 shared topics |
Garage Door Services and Sales | Greater Salt Lake City | en | home-improvementWix | robotsllmsaihumans | emailphone | none |
| tjacs.co ↗ | 67 match 1 shared topics |
J&D Cleaning and Services | Colombia en | home-improvement | robotsllmsaihumans | emailphone | none |
| jedcleaning.net ↗ | 67 match 1 shared topics |
J&D Cleaning and Services | United States~ en | home-improvement | robotsllmsaihumans | emailphone | none |
| jbhomefix.com ↗ | 67 match 1 shared topics |
Reliable Handyman Services in Toronto | J&B Home Fix | en | home-improvement | robotsllmsaihumans | emailphone | none |
| webcoaustin.com ↗ | 67 match 1 shared topics |
Fireplace Distributor | Fireplaces | Austin, TX : Webco Redesign | United States~ en | home-improvementWordPress | robotsllmsaihumans | emailphone | none |
| simivalley-hvac.com ↗ | 67 match 1 shared topics |
HVAC Services | en | home-improvement | robotsllmsaihumans | emailphone | none |
| mysolarhome.co.uk ↗ | 67 match 1 shared topics |
UPVC and Kitchen Spraying Services Lancashire North West | United Kingdom en | home-improvementWordPressWooCommerce | robotsllmsaihumans | emailphone | none |