| Domain | Match | Title | Country/Lang | Category | AI files | Contact | AI-protection |
|---|---|---|---|---|---|---|---|
| albrightsteel.com ↗ | 70 match 2 shared topics |
Albright Steel - Home | en | construction-industry | robotsllmsaihumans | emailphone | none |
| albrightsteelandwire.com ↗ | 70 match 2 shared topics |
Albright Steel - Home | en | construction-industry | robotsllmsaihumans | emailphone | none |
| albrightsteel.net ↗ | 70 match 2 shared topics |
Albright Steel - Home | en | construction-industry | robotsllmsaihumans | emailphone | none |
| cscsteelusa.com ↗ | 66 match 2 shared topics |
CSC - Canam Steel Corporation | en | construction-industryWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| herbosteel.com ↗ | 66 match 2 shared topics |
Home-My Steel | en | construction-industry | robotsllmsaihumans | emailphone | none |
| poncesteelfab.com ↗ | 66 match 2 shared topics |
Ponce Steel Fab | en | construction-industryWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| compositesteel.com ↗ | 66 match 2 shared topics |
Composite Steel Products | en | metals-industrySquarespaceMagento | robotsllmsaihumans | emailphone | partial · 8 |
| showssteel.com ↗ | 65 match 2 shared topics |
Home - Shows Steel | en | construction-industryWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| ethiopiansteelplc.com ↗ | 65 match 2 shared topics |
Ethiopian Steel PLC | en | construction-industryWordPress | robotsllmsaihumans | emailphone | none |
| krausssteel.com ↗ | 65 match 2 shared topics |
Home - KRAUSS STEEL | en | construction-industryJoomla | robotsllmsaihumans | emailphone | none |
| heritagesteelsupply.com ↗ | 65 match 2 shared topics |
Heritage Steel Supply | en | construction-industryWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| lampmetaltrusses.com ↗ | 65 match 2 shared topics |
LAMP - A a metal trusses company | en | metals-industryWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| mcgillsteel.com ↗ | 65 match 2 shared topics |
McGill Steel | en | metals-industry | robotsllmsaihumans | emailphone | none |
| montazne-hale.com ↗ | 65 match 2 shared topics |
Početna - MK STEEL DOO | en | construction-industryWordPress | robotsllmsaihumans | emailphone | none |
| shriefsteel.com ↗ | 65 match 2 shared topics |
Shrief Steel | en | metals-industryWordPress | robotsllmsaihumans | emailphone | none |
| shyamasteel.com ↗ | 65 match 2 shared topics |
Shyama Steel | en | metals-industry | robotsllmsaihumans | emailphone | none |
| alhaddafalaqwiyarawmaterials.com ↗ | 65 match 2 shared topics |
Home - AL HADDAF AL AQWIYA TRADING OF MATERIALS AND RAW MATERIALS COMPANY - BFC | en | metals-industryWordPress | robotsllmsaihumans | emailphone | none |
| mckinneysteel.com ↗ | 64 match 2 shared topics |
McKinney Steel | en | construction-industryWordPress | robotsllmsaihumans | emailphone | none |