| Domain | Match | Title | Country/Lang | Category | AI files | Contact | AI-protection |
|---|---|---|---|---|---|---|---|
| directcarpetcentre.com ↗ | 67 match 1 shared topics |
Direct Carpet Centre | Carpets, Wood, Laminate, Vinyl Flooring | Teesside | en | home-improvement | robotsllmsaihumans | emailphone | none |
| houseofcarpets.co ↗ | 66 match 1 shared topics |
Home - House of Carpets | Colombia en | home-improvementJoomla | robotsllmsaihumans | emailphone | none |
| direct-eg.net ↗ | 66 match 1 shared topics |
Home | Direct For Insulations | en | home-improvement | robotsllmsaihumans | emailphone | none |
| hestforge.com ↗ | 65 match 1 shared topics |
HestForge — Local Home Services Directory | en | home-improvement | robotsllmsaihumans | emailphone | none |
| directplumbingservicesllc.com ↗ | 65 match 1 shared topics |
Home | Direct Plumbing Services | en | home-improvement | robotsllmsaihumans | emailphone | none |
| bayfieldflooring.com ↗ | 65 match 1 shared topics |
Barrie Flooring | Bayfield Flooring & Carpet | en | home-improvementWordPress | robotsllmsaihumans | emailphone | none |
| oviedocarpetcleaningservice.com ↗ | 65 match 1 shared topics |
Oviedo Carpet Cleaning | (407) 440-0934 | en | home-improvement | robotsllmsaihumans | emailphone | none |
| lakemarycarpetcleaningservice.com ↗ | 64 match 1 shared topics |
Lake Mary Carpet Cleaning | (407) 440-0901 | en | home-improvement | robotsllmsaihumans | emailphone | none |
| estrellahub.com ↗ | 64 match 1 shared topics |
Estrella Hub - Estrella Mountain Ranch Business Directory | en | home-improvementWordPressWooCommerce | robotsllmsaihumans | emailphone | partial · 8 |
| meadowwoodscarpetcleaningservice.com ↗ | 64 match 1 shared topics |
Meadow Woods Carpet Cleaning | (407) 495-2693 | en | home-improvement | robotsllmsaihumans | emailphone | none |
| heritage-carpet.com ↗ | 64 match 1 shared topics |
Flooring Store in North Canton, OH | Heritage Carpet and Flooring | United States~ en | home-improvement | robotsllmsaihumans | emailphone | none |
| shorelinecarpetwa.com ↗ | 64 match 1 shared topics |
Shoreline Carpet Cleaning Company | Carpet Cleaning Services | United States~ en | home-improvement | robotsllmsaihumans | emailphone | none |
| conleyscarpetcleaningplus.com ↗ | 64 match 1 shared topics |
Conley's Carpet Cleaning in Virginia Beach, VA | en | home-improvementWordPress | robotsllmsaihumans | emailphone | none |
| alexscarpetcleaningnc.com ↗ | 64 match 1 shared topics |
Alex’s Carpet Cleaning | Carpet Cleaning in Charlotte | United States~ en | home-improvementLightspeed | robotsllmsaihumans | emailphone | none |
| shroats.com ↗ | 64 match 1 shared topics |
Carpet Repair Milwaukee – Shroat's Carpet Repair & Cleaning | en | home-improvementWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| lancashirecarpetcleaner.com ↗ | 63 match 1 shared topics |
Carpet Cleaning in Whalley, Clitheroe, Blackburn - LancashireCarpetCleaner | en | home-improvementWix | robotsllmsaihumans | emailphone | none |
| 1beecleancarpet.com ↗ | 63 match 1 shared topics |
Welcome to Bee Clean Carpet and Floor Restoration - Southwest Missouri | en | home-improvement | robotsllmsaihumans | emailphone | none |
| bayarea-homeservices.com ↗ | 63 match 1 shared topics |
Bay Area Home Services | Chimney & Carpet Experts | en | home-improvement | robotsllmsaihumans | emailphone | none |