similar sites

Browse

Tools

🚀Submit Your Site to AIPush your URL to AI search engines 🤖AI Crawler CheckerSee which AI bots your site blocks 🎯AI Readiness CheckerScore your site 0–100 for AI 🔗Backlink CheckerWho links to any site — free All tools →

Sites similar to alwaysreadyseptic.com

Alwaysreadyseptic alternatives & similar sites

Septic Service Claremore, Collinsville, Owasso OK Septic Tank Cleaning Pumping Repair Aerobic Systems | Always Ready Septic — 18 websites ranked by shared content topics, category and on-page relevance.

Each result shows its full tech stack, contacts and AI-policy — not just a name · Browse all sites in Water Services →

Domain	Match	Title	Country/Lang	Category	AI files	Contact	AI-protection
mcleanseptic.com ↗	73 match 1 shared topics	McLean Septic Services \| Septic Pumping & Services	en	water-services WordPress WooCommerce	robotsllmsaihumans	email phone	none
kamziksepticandportabletoilets.com ↗	72 match 1 shared topics	Septic tank cleaning \| portable toilet rental \| Johnstown PA \| Kamzik Septic Service	United States~ en	water-services WordPress	robotsllmsaihumans	emailphone	none
knoxvilleseptic.com ↗	72 match 1 shared topics	Knoxville Septic - Septic Pumping & Repair - Knoxville / Surrounding Areas	United States~ en	water-services WordPress	robotsllmsaihumans	emailphone	none
kerkstraseptic.com ↗	72 match 1 shared topics	Kerkstra Septic - Septic Tank Cleaning	en	water-services WordPress WooCommerce	robotsllmsaihumans	email phone	none
lawrenceville-sewerseptic.com ↗	71 match 1 shared topics	Lawrenceville Septic Tank Pumping, Cleaning, Inspections \| Suwanee, Gwinnett County GA	United States~ en	water-services WordPress	robotsllmsaihumans	emailphone	none
casagrandesepticservice.com ↗	71 match 1 shared topics	Casa Grande Septic Service \| #1 Leader in Septic Service \| Home	en	water-services WordPress WooCommerce	robotsllmsaihumans	emailphone	none
fredcook.com ↗	71 match 1 shared topics	Expert Septic Services in Montrose, NY - Septic Tank Pumping	United States~ en	water-services WordPress	robotsllmsaihumans	emailphone	none
pumperz.com ↗	71 match 1 shared topics	NH Septic Services For Residential Septic Systems and Commercial Septic Systems	en	water-services	robotsllmsaihumans	emailphone	none
foresmanseptic.com ↗	71 match 1 shared topics	Septic Services Near Me \| Williamsport, PA \| Septic Tank Pumping	en	water-services Wix	robots llmsaihumans	emailphone	none
foresmansepticservices.com ↗	71 match 1 shared topics	Septic Services Near Me \| Williamsport, PA \| Septic Tank Pumping	en	water-services Wix	robots llmsaihumans	emailphone	none
kelleysseptictankandsewerservice.com ↗	71 match 1 shared topics	Septic & Sewer Services Decatur, IL \| Cleaning & Repairs	en	water-services WordPress	robotsllmsaihumans	email phone	none
kentuckysepticcleaning.com ↗	71 match 1 shared topics	Kentucky Septic Cleaning \| KY Septic Cleaning	en	water-services	robotsllmsaihumans	emailphone	none
kloozseptic.net ↗	71 match 1 shared topics	Walt Kucharski Septic Service, Inc. \| Septic Service near Cleveland	en	water-services	robotsllmsaihumans	emailphone	none
kloozseptictank.com ↗	71 match 1 shared topics	Walt Kucharski Septic Service, Inc. \| Septic Service near Cleveland	en	water-services	robotsllmsaihumans	emailphone	none
keithssepticpumping.com ↗	70 match 1 shared topics	Keith’s Tank Service - Fayetteville, TN Septic Service	United States~ en	water-services WordPress	robotsllmsaihumans	emailphone	none
deckersepticexcavation.com ↗	70 match 1 shared topics	Reliable Septic Services \| Deck Septic Services	en	water-services WordPress	robotsllmsaihumans	email phone	none
leguesepticservices.com ↗	70 match 1 shared topics	LEGUE SEPTIC SERVICES - Septic Tank Services	en	water-services Weebly	robotsllmsaihumans	emailphone	none
fraservalleyseptic.ca ↗	70 match 1 shared topics	Langley Septic Tank Services - Fraser Valley Septic	Canada en	water-services WordPress WooCommerce	robotsllmsaihumans	emailphone	none

How the match score works

Each match is a 0–100 similarity score — the higher it is, the more two sites resemble one another. It’s computed automatically from our own crawl data (never from what a site says about itself) by combining several independent signals, so a high score means several of them point the same way:

shared topics how many of the same fine‑grained content topics (IAB sub‑categories) both sites cover — the main signal.
same category whether they sit in the same business / industry category.
content & title how closely their titles and page descriptions line up in wording and meaning.

No single signal decides the result — they’re blended together. Treat the score as a way to rank candidates rather than an absolute percentage; the chips on each result show which signals contributed.