| Domain | Match | Title | Country/Lang | Category | AI files | Contact | AI-protection |
|---|---|---|---|---|---|---|---|
| acservicesqatar.com ↗ | 72 match 1 shared topics |
Home - AC SERVICES IN QATAR | en | home-improvementWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| velourhomecleaning.net ↗ | 72 match 1 shared topics |
Velour Home Cleaning Services | en | home-improvement | robotsllmsaihumans | emailphone | none |
| thelifehomeservicesllc.com ↗ | 72 match 1 shared topics |
The Life Home Services Gutter Cleaning | United States~ en | home-improvementWordPress | robotsllmsaihumans | emailphone | none |
| 1spclean.com ↗ | 72 match 1 shared topics |
Cleaning and Property Maintenance Services in Delaware | en | home-improvementWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| newimagegaragedoor.com ↗ | 71 match 1 shared topics |
Professional Garage Door Services | Trusted Experts | en | home-improvement | robotsllmsaihumans | emailphone | none |
| jbm-cleaning.com ↗ | 71 match 1 shared topics |
JBM Cleaning - Professional Home & Commercial Cleaning Services in Sydney | Australia~ en | home-improvement | robotsllmsaihumans | emailphone | none |
| bleuhandyman.com ↗ | 71 match 1 shared topics |
BLEU Handyman & Cleaning Services | Sterling, VA | en | home-improvement | robotsllmsaihumans | emailphone | none |
| bngcleaning.com ↗ | 71 match 1 shared topics |
B&G Cleaning Services | en | home-improvement | robotsllmsaihumans | emailphone | none |
| tscleaningandservices.com ↗ | 71 match 1 shared topics |
T's Cleaning and Services - Home | en | home-improvementWordPress | robotsllmsaihumans | emailphone | none |
| thelakelandac.com ↗ | 71 match 1 shared topics |
Lakeland Air Conditioning | Trusted HVAC Services in Lakeland FL | en | home-improvementWordPress | robotsllmsaihumans | emailphone | none |
| guevaracorporation.com ↗ | 71 match 1 shared topics |
Guevara Corporation - Reliable Home Services | en | home-improvementWeebly | robotsllmsaihumans | emailphone | none |
| nextdoorserviceskc.com ↗ | 71 match 1 shared topics |
Next Door Home Services KC | Trusted KC Contractors | en | home-improvement | robotsllmsaihumans | emailphone | none |
| venturacleaningservice.com ↗ | 71 match 1 shared topics |
Ventura Cleaning Services - Keeping Your Home Shipshape! | en | home-improvement | robotsllmsaihumans | emailphone | none |
| achelpline.com ↗ | 71 match 1 shared topics |
ACHELPLINE | Trusted Air Conditioning Services Near You | en | home-improvement | robotsllmsaihumans | emailphone | partial · 8 |
| 360cleanit.com ↗ | 71 match 1 shared topics |
Phoenix Cleaning Services by 360 Home Services | en | home-improvementWordPress | robotsllmsaihumans | emailphone | none |
| ladiesmaidsandmen.com ↗ | 71 match 1 shared topics |
Faith-Based Handyman and Cleaning Home Services | Ladies Maids and Men | en | home-improvement | robotsllmsaihumans | emailphone | none |
| qualityprocleaningservicesllc.com ↗ | 71 match 1 shared topics |
Trusted Cleaning Services in Asheville, NC | Quality Pro Cleaning | en | home-improvement | robotsllmsaihumans | emailphone | none |
| janesvillechimneyandfireplace.com ↗ | 70 match 1 shared topics |
Chimney Cleaning & Fireplace Services | Janesville | en | home-improvementSquarespaceMagento | robotsllmsaihumans | emailphone | none |