| Domain | Match | Title | Country/Lang | Category | AI files | Contact | AI-protection |
|---|---|---|---|---|---|---|---|
| melilloslawncareandlandscaping.com ↗ | 77 match 2 shared topics |
MELILLO'S Lawn Care and Landscaping Inc.: Lawn Care & Landscaping Services | en | landscaping | robotsllmsaihumans | emailphone | none |
| desirablelandlawncare.com ↗ | 76 match 2 shared topics |
Desirable Land Lawn Care | Landscaping Tree Services Elgin SC | en | landscapingLightspeed | robotsllmsaihumans | emailphone | none |
| adlawnlandscape.com ↗ | 76 match 2 shared topics |
Lawn Care and Landscaping In Monument | en | landscapingWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| 3bpropertymaintenancellc.com ↗ | 76 match 2 shared topics |
3B Property Maintenance | lawn care and landscaping service | Home | en | landscaping | robotsllmsaihumans | emailphone | none |
| mcnavishlawncareandlandscaping.com ↗ | 76 match 2 shared topics |
McNavish Lawncare and Landscaping Offers Lawn Care Services in Chagrin Falls, OH 44023 | United States~ en | landscaping | robotsllmsaihumans | emailphone | none |
| moreartlandscapeservice.com ↗ | 76 match 2 shared topics |
Landscaping Services Rialto | Lawn Care and Maintenance | en | landscaping | robotsllmsaihumans | emailphone | none |
| myprecisionlandscaping.com ↗ | 76 match 2 shared topics |
Precision Landscaping: Expert Lawn Care and Landscaping in Narrows VA | en | landscaping | robotsllmsaihumans | emailphone | none |
| theoutdoorsmanva.com ↗ | 76 match 2 shared topics |
Lawn Care and Landscaping Services | The Outdoorsman VA | en | landscapingWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| singhasphaltpainting.com ↗ | 76 match 2 shared topics |
Trusted Landscaping and Lawn Care Services in Queens, NY | United States~ en | landscaping | robotsllmsaihumans | emailphone | none |
| crystaledge-landscaping.com ↗ | 76 match 2 shared topics |
Crystal Edge Landscaping | Reliable Lawn Care Service | McHenry, IL | United States~ en | landscapingLightspeed | robotsllmsaihumans | emailphone | none |
| cuttingedgeyardservice.com ↗ | 76 match 2 shared topics |
Cutting Edge Yard Service - Lawn Care And Landscaping Services | en | landscapingWordPress | robotsllmsaihumans | emailphone | none |
| millerslanddesign.com ↗ | 75 match 2 shared topics |
Millers Land Design: Trusted lawn care and landscaping in Knoxville | en | landscaping | robotsllmsaihumans | emailphone | none |
| dobetterlandscaping.com ↗ | 75 match 2 shared topics |
DoBetter Landscaping: expert landscaping and lawn care services | en | landscaping | robotsllmsaihumans | emailphone | none |
| frankslawnandhandymanservice.com ↗ | 75 match 2 shared topics |
Frank’s Lawn Services | Lawn Care & Landscaping in Audubon, NJ | en | landscaping | robotsllmsaihumans | emailphone | none |
| rewardlawn.com ↗ | 75 match 2 shared topics |
Expert Lawn Care and Landscaping Services for Your Home | Reward Lawn Maintenance | en | landscaping | robotsllmsaihumans | emailphone | none |
| mooselawnandlandscape.com ↗ | 75 match 2 shared topics |
Lawn Care & Landscaping Services in Goldsboro, NC | Moose Lawncare | United States~ en | landscaping | robotsllmsaihumans | emailphone | none |
| dslawncare.net ↗ | 75 match 2 shared topics |
D&S Lawn Care and Snow Removal | Landscaping & Snow Removal Services | en | landscaping | robotsllmsaihumans | emailphone | none |
| 3bearslandscaping.com ↗ | 75 match 2 shared topics |
3 Bears Landscaping: Sustainable Lawn Care and Landscape Design in Minneapolis | en | landscaping | robotsllmsaihumans | emailphone | none |