similar sites

Browse

AI Report Tools

Sites similar to sofflores.com

Sofflores alternatives & similar sites

Jardín de sueños — 18 websites ranked by shared content topics, category and on-page relevance.

Each result shows its full tech stack, contacts and AI-policy — not just a name · Browse all sites in Early Childhood Education →

Domain	Match	Title	Country/Lang	Category	AI files	Contact	AI-protection
acaech.org ↗	62 match 1 shared topics	Asociación de Apoyo y Educación en Chiapas A.C.	es	early-childhood-education WordPress	robots llmsaihumans	email phone	none
happyedupy.com ↗	62 match 1 shared topics	Happy Paraguay \| Escuela de Habilidades para Niños	es	early-childhood-education WordPress	robots llmsaihumans	emailphone	none
planetamontessori.com ↗	61 match 1 shared topics	El Método Montessori para niños de 0 a 6 años	es	early-childhood-education	robotsllmsaihumans	emailphone	none
aventuramontessori.com ↗	61 match 1 shared topics	Aventura Montessori: Despierta el Potencial de tu Hijo en sus primeros años…	es	early-childhood-education	robotsllmsaihumans	emailphone	none
actividadesmontessoriencasa.com ↗	61 match 1 shared topics	Actividades Montessori en Casa — 25 experiencias reales para niños de 2 a 4 años	es	early-childhood-education	robotsllmsaihumans	emailphone	none
1-2-3piruetaspr.com ↗	61 match 1 shared topics	1-2-3 Piruetas – Consultoría y servicios educativos dirigidos a familias, organizaciones y docentes que impactan a la población de cero a ocho años.	es	early-childhood-education WordPress WooCommerce	robotsllmsaihumans	emailphone	none
academialachispa.com ↗	61 match 1 shared topics	Centro de Educación y Terapias "la Chispa"	es	early-childhood-education	robotsllmsaihumans	emailphone	none
activityclass.com ↗	61 match 1 shared topics	Programas educativos - Aula integral de Formación	es	early-childhood-education WordPress	robotsllmsaihumans	emailphone	none
dicet.org ↗	61 match 1 shared topics	DICET A.C Iniciativa de padres y madres - Inicio	es	early-childhood-education Weebly	robotsllmsaihumans	emailphone	none
accentescolademusica.cat ↗	61 match 1 shared topics	Escola de Música Accent \| Sagrada Família · BARCELONA	es	early-childhood-education WordPress	robotsllmsaihumans	email phone	none
aventurasfinancieras.com ↗	61 match 1 shared topics	Aprendiendo de Dinero \| Cuento de educación financiera	es	early-childhood-education	robotsllmsaihumans	emailphone	none
actividadesparapreescolar.net ↗	61 match 1 shared topics	Actividades Para Preescolar - Mas de 1000 Fichas para Imprimir 2026	es	early-childhood-education WordPress	robotsllmsaihumans	emailphone	none
academiasquad.com ↗	61 match 1 shared topics	Academia de Música y Neurodesarrollo Infantil en Colombia \| SQUAD	es	early-childhood-education WordPress	robots llmsaihumans	emailphone	partial · 8
desteledu.com ↗	61 match 1 shared topics	DESTEL - Desarrollo del Lenguaje \| Guía Profesional para Niños 3-5 Años	es	early-childhood-education Spree Commerce	robotsllmsaihumans	emailphone	none
acmilancampmexicocity.com ↗	60 match 1 shared topics	AC Milan Camp Mexico City \| Escuela Oficial Infantil y juvenil en la Ciudad de México	es	early-childhood-education WordPress WooCommerce	robotsllmsaihumans	emailphone	none
actividadesdeinfantilyprimaria.com ↗	60 match 1 shared topics	Actividades de infantil y primaria - Recursos para trabajar en infantil y primaria	es	early-childhood-education WordPress	robotsllmsaihumans	emailphone	none
actividadesdeinfantil.com ↗	60 match 1 shared topics	ACTIVIDADES DE EDUCACIÓN INFANTIL – Recursos e ideas sencillas y divertidas para Educación Infantil. Para aprender jugando en tu aula o en tu casa	es	early-childhood-education WordPress	robotsllmsaihumans	emailphone	none
cuentilandiamundodiversidad.com ↗	60 match 1 shared topics	Cuentilandia Mundo Diversidad – Asesoría Educativa	es	early-childhood-education WordPress WooCommerce	robotsllmsaihumans	emailphone	none

How the match score works

Each match is a 0–100 similarity score — the higher it is, the more two sites resemble one another. It’s computed automatically from our own crawl data (never from what a site says about itself) by combining several independent signals, so a high score means several of them point the same way:

shared topics how many of the same fine‑grained content topics (IAB sub‑categories) both sites cover — the main signal.
same category whether they sit in the same business / industry category.
content & title how closely their titles and page descriptions line up in wording and meaning.

No single signal decides the result — they’re blended together. Treat the score as a way to rank candidates rather than an absolute percentage; the chips on each result show which signals contributed.