similar sites

Browse

AI Report Tools

Sites similar to mediamd.com

Mediamd alternatives & similar sites

MediaMD | The Growth Engine for the Practices Patients Choose — 18 websites ranked by shared content topics, category and on-page relevance.

Each result shows its full tech stack, contacts and AI-policy — not just a name · Browse all sites in Marketing And Advertising →

Domain	Match	Title	Country/Lang	Category	AI files	Contact	AI-protection
mdappointtarget.com ↗	72 match 2 shared topics	Target Patients MD - Medical Practice Growth Experts	en	marketing-and-advertising WordPress WooCommerce	robotsllmsaihumans	emailphone	none
mdtargetedpatient.com ↗	72 match 2 shared topics	Target Patients MD - Medical Practice Growth Experts	en	marketing-and-advertising WordPress WooCommerce	robotsllmsaihumans	emailphone	none
medsites.app ↗	67 match 2 shared topics	MedSites — Medical practice websites that bring new patients in.	United States~ en	marketing-and-advertising	robots llmsaihumans	emailphone	none
medhealthmarketing.com ↗	66 match 2 shared topics	Proven Clinic Growth & Patient Leads \| Med Health Marketing	en	healthcare-industry	robotsllmsaihumans	emailphone	none
medimktg.com ↗	66 match 2 shared topics	Medical Marketing \| Get More Patients	en	marketing-and-advertising WordPress WooCommerce	robots llmsaihumans	email phone	none
4healthcaremarketing.com ↗	66 match 2 shared topics	4 Healthcare Marketing: Digital Marketing Agency for Private Practices	en	marketing-and-advertising	robotsllmsaihumans	emailphone	none
innerbeauty-aesthetics.com ↗	65 match 2 shared topics	Marketing for Medical Practice \| Spark Medical Marketing	en	marketing-and-advertising WordPress WooCommerce	robotsllmsaihumans	emailphone	none
barnesvillefamilyhealthwellness.com ↗	65 match 2 shared topics	Marketing for Medical Practice \| Spark Medical Marketing	en	marketing-and-advertising WordPress WooCommerce	robotsllmsaihumans	emailphone	none
medical-rank.com ↗	65 match 2 shared topics	Local SEO Services for Healthcare Practitioners \| Medical Rank	United States~ en	marketing-and-advertising	robotsllmsaihumans	emailphone	none
medicogrowth.com ↗	65 match 2 shared topics	Healthcare Marketing Agency \| Grow More Patients Online	en	healthcare-industry WordPress	robots llmsaihumans	emailphone	none
dashlogin.com ↗	65 match 2 shared topics	MeasureMD — Healthcare Marketing Attribution for Surgical Practices	en	marketing-and-advertising	robotsllmsaihumans	emailphone	none
measuremd.com ↗	65 match 2 shared topics	MeasureMD — Healthcare Marketing Attribution for Surgical Practices	en	marketing-and-advertising	robotsllmsaihumans	emailphone	none
medigrow.app ↗	65 match 2 shared topics	MediGrow - Stop Losing Patients. Convert Every Inquiry.	en	healthcare-industry	robotsllmsaihumans	email phone	none
oncallads.com ↗	65 match 2 shared topics	OnCall Ads \| Healthcare Patient Acquisition for DPC, Dental, Med-Spa & More	United States~ en	marketing-and-advertising	robotsllmsaihumans	emailphone	none
medihyve.com ↗	65 match 2 shared topics	medihyve.com – Connecting Clinics to the Patients Who Need Them Most.	en	healthcare-industry WordPress	robotsllmsaihumans	emailphone	none
medicalplusteam.com ↗	65 match 2 shared topics	Medical+ \| The Healthcare Marketing Firm for Private Clinics	Canada~ en	marketing-and-advertising	robotsllmsaihumans	emailphone	none
medicalplusglobal.com ↗	65 match 2 shared topics	Medical+ \| The Healthcare Marketing Firm for Private Clinics	Canada~ en	marketing-and-advertising	robotsllmsaihumans	emailphone	none
medicalplusgrowth.com ↗	65 match 2 shared topics	Medical+ \| The Healthcare Marketing Firm for Private Clinics	Canada~ en	marketing-and-advertising	robotsllmsaihumans	emailphone	none

How the match score works

Each match is a 0–100 similarity score — the higher it is, the more two sites resemble one another. It’s computed automatically from our own crawl data (never from what a site says about itself) by combining several independent signals, so a high score means several of them point the same way:

shared topics how many of the same fine‑grained content topics (IAB sub‑categories) both sites cover — the main signal.
same category whether they sit in the same business / industry category.
content & title how closely their titles and page descriptions line up in wording and meaning.

No single signal decides the result — they’re blended together. Treat the score as a way to rank candidates rather than an absolute percentage; the chips on each result show which signals contributed.