similar sites

Browse

AI Report Tools

Sites similar to measuremd.com

Measuremd alternatives & similar sites

MeasureMD — Healthcare Marketing Attribution for Surgical Practices — 18 websites ranked by shared content topics, category and on-page relevance.

Each result shows its full tech stack, contacts and AI-policy — not just a name · Browse all sites in Marketing And Advertising →

Domain	Match	Title	Country/Lang	Category	AI files	Contact	AI-protection
dashlogin.com ↗	100 match 2 shared topics	MeasureMD — Healthcare Marketing Attribution for Surgical Practices	en	marketing-and-advertising	robotsllmsaihumans	emailphone	none
4healthcaremarketing.com ↗	73 match 2 shared topics	4 Healthcare Marketing: Digital Marketing Agency for Private Practices	en	marketing-and-advertising	robotsllmsaihumans	emailphone	none
barnesvillefamilyhealthwellness.com ↗	71 match 2 shared topics	Marketing for Medical Practice \| Spark Medical Marketing	en	marketing-and-advertising WordPress WooCommerce	robotsllmsaihumans	emailphone	none
vivalifecare.com ↗	71 match 2 shared topics	Digital Marketing Agency for Doctors \| Healthcare Marketing	en	marketing-and-advertising WordPress	robotsllmsaihumans	emailphone	none
bryancush.com ↗	71 match 2 shared topics	Bryan Cush - Healthcare Marketing Leader	en	healthcare-industry WordPress	robotsllmsaihumans	emailphone	none
medicodigital.co.uk ↗	71 match 2 shared topics	Healthcare Marketing Agency \| MEDICO DIGITAL	United Kingdom en	marketing-and-advertising	robotsllmsaihumans	email phone	none
fairo.ai ↗	70 match 2 shared topics	Fairo - Healthcare Marketing for the Agent Era	en	marketing-and-advertising	robotsllmsaihumans	emailphone	none
onesourcemd.com ↗	70 match 2 shared topics	One SourceMD - Marketing Services Agency for Healthcare	en	healthcare-industry WordPress WooCommerce	robotsllmsaihumans	emailphone	none
resonetrics.com ↗	70 match 2 shared topics	Digital and Social Media Marketing \| Healthcare Marketing Experts	en	healthcare-industry WordPress WooCommerce	robots llmsaihumans	emailphone	none
helvet-group.com ↗	70 match 2 shared topics	Helvet Health - Healthcare marketing and communication agency	en	marketing-and-advertising	robotsllmsaihumans	emailphone	none
doceree.com ↗	70 match 2 shared topics	Healthcare Marketing Platform for Pharma \| Doceree	en	marketing-and-advertising	robotsllmsaihumans	emailphone	none
hellogetconnected.com ↗	70 match 2 shared topics	Hello Get Connected \| Healthcare Marketing Agency	en	marketing-and-advertising	robotsllmsaihumans	emailphone	none
buildvitalspark.com ↗	70 match 2 shared topics	Healthcare Marketing Agency \| 100% HIPAA Compliant \| Vital Spark	en	marketing-and-advertising	robotsllmsaihumans	emailphone	none
3kangaroos.com ↗	70 match 2 shared topics	3KANGAROOS \| Healthcare Digital Marketing Agency	en	marketing-and-advertising WordPress WooCommerce	robotsllmsaihumans	emailphone	none
houstonshoulderclinic.com ↗	69 match 2 shared topics	Digital Marketing Solutions for Healthcare Professionals\| Healthcare Web Marketing	United States~ en	marketing-and-advertising	robotsllmsaihumans	email phone	none
vitruviusscience.com ↗	69 match 2 shared topics	RevHealth \| Healthcare Marketing Agency Driving Brand Transformation	en	marketing-and-advertising HubSpot	robotsllmsaihumans	emailphone	none
vitruvius-science.com ↗	69 match 2 shared topics	RevHealth \| Healthcare Marketing Agency Driving Brand Transformation	en	marketing-and-advertising HubSpot	robotsllmsaihumans	emailphone	none
medibrandox.com ↗	69 match 2 shared topics	Healthcare Marketing for Doctors, Hospitals & Clinics - Medibrandox	India~ en	marketing-and-advertising	robotsllmsaihumans	email phone	none

How the match score works

Each match is a 0–100 similarity score — the higher it is, the more two sites resemble one another. It’s computed automatically from our own crawl data (never from what a site says about itself) by combining several independent signals, so a high score means several of them point the same way:

shared topics how many of the same fine‑grained content topics (IAB sub‑categories) both sites cover — the main signal.
same category whether they sit in the same business / industry category.
content & title how closely their titles and page descriptions line up in wording and meaning.

No single signal decides the result — they’re blended together. Treat the score as a way to rank candidates rather than an absolute percentage; the chips on each result show which signals contributed.