similar sites

Browse

AI Report Tools

Sites similar to luthertech.com

Luthertech alternatives & similar sites

Luther Tech — 18 websites ranked by shared content topics, category and on-page relevance.

Each result shows its full tech stack, contacts and AI-policy — not just a name · Browse all sites in Marketing And Advertising →

Domain	Match	Title	Country/Lang	Category	AI files	Contact	AI-protection
luthertech.co.uk ↗	100 match 2 shared topics	Luther Tech	GB en	marketing-and-advertising Weebly	robotsllmsaihumans	email phone	none
barnesvillefamilyhealthwellness.com ↗	64 match 2 shared topics	Marketing for Medical Practice \| Spark Medical Marketing	en	marketing-and-advertising WordPress WooCommerce	robotsllmsaihumans	emailphone	none
carsdealpaystech.com ↗	64 match 2 shared topics	Target Patients MD - Medical Practice Growth Experts	en	marketing-and-advertising WordPress WooCommerce	robotsllmsaihumans	emailphone	none
carsdealerspaytechs.com ↗	64 match 2 shared topics	Target Patients MD - Medical Practice Growth Experts	en	marketing-and-advertising WordPress WooCommerce	robotsllmsaihumans	emailphone	none
carsdealer-paytech.com ↗	64 match 2 shared topics	Target Patients MD - Medical Practice Growth Experts	en	marketing-and-advertising WordPress WooCommerce	robotsllmsaihumans	emailphone	none
carsdealerspaystechs.com ↗	64 match 2 shared topics	Target Patients MD - Medical Practice Growth Experts	en	marketing-and-advertising WordPress WooCommerce	robotsllmsaihumans	emailphone	none
luminusmedia.com ↗	64 match 2 shared topics	Healthcare Marketing Agency in Buffalo, NY ǀ Luminus Agency	en	marketing-and-advertising WordPress	robotsllmsaihumans	email phone	none
sanesocialmedia.com ↗	64 match 2 shared topics	Medical Digital Marketing \| Healthcare Marketing That Delivers	en	marketing-and-advertising WordPress	robotsllmsaihumans	email phone	none
upexon.com ↗	64 match 2 shared topics	Healthcare Marketing Strategist for Doctors & Clinics \| Upexon	en	marketing-and-advertising WordPress	robotsllmsaihumans	email phone	none
6columns.com ↗	64 match 2 shared topics	6 Columns Marketing Group - 6 Columns Marketing Group6 Columns Marketing Group	US~ en	marketing-and-advertising WordPress	robotsllmsaihumans	emailphone	none
autumdigital.com ↗	64 match 2 shared topics	Healthcare Digital Marketing Agency \| Autum Digital	en	marketing-and-advertising Sanity	robotsllmsaihumans	emailphone	none
menshealthmatters.co.uk ↗	63 match 2 shared topics	Solutions - Oi Digital Ltd	GB en	marketing-and-advertising WordPress	robotsllmsaihumans	emailphone	none
oidigital.co.uk ↗	63 match 2 shared topics	Solutions - Oi Digital Ltd	GB en	marketing-and-advertising WordPress	robotsllmsaihumans	emailphone	none
hbside.com ↗	63 match 2 shared topics	Conexiant - Client Solutions	en	marketing-and-advertising	robotsllmsaihumans	emailphone	none
denverhandsurgeon.com ↗	63 match 2 shared topics	Digital Marketing Solutions for Healthcare \| Healthcare Web Marketing	en	marketing-and-advertising	robotsllmsaihumans	emailphone	none
detroithipandknee.com ↗	63 match 2 shared topics	Digital Marketing Solutions for Healthcare \| Healthcare Web Marketing	en	marketing-and-advertising	robotsllmsaihumans	emailphone	none
hanmdigital.com ↗	63 match 2 shared topics	home	en	healthcare-industry	robotsllmsaihumans	emailphone	none
happimed.com ↗	63 match 2 shared topics	Healthcare Digital Marketing Agency \| HappiMed	en	marketing-and-advertising WordPress	robotsllmsaihumans	emailphone	none

How the match score works

Each match is a 0–100 similarity score — the higher it is, the more two sites resemble one another. It’s computed automatically from our own crawl data (never from what a site says about itself) by combining several independent signals, so a high score means several of them point the same way:

shared topics how many of the same fine‑grained content topics (IAB sub‑categories) both sites cover — the main signal.
same category whether they sit in the same business / industry category.
content & title how closely their titles and page descriptions line up in wording and meaning.

No single signal decides the result — they’re blended together. Treat the score as a way to rank candidates rather than an absolute percentage; the chips on each result show which signals contributed.