similar sites

Browse

AI Report Tools

Sites similar to jointelev8.com

Jointelev8 alternatives & similar sites

Home - Join Telev8 — 18 websites ranked by shared content topics, category and on-page relevance.

Each result shows its full tech stack, contacts and AI-policy — not just a name · Browse all sites in Marketing And Advertising →

Domain	Match	Title	Country/Lang	Category	AI files	Contact	AI-protection
hanmdigital.com ↗	68 match 2 shared topics	home	en	healthcare-industry	robotsllmsaihumans	emailphone	none
aya-aboulazm.com ↗	65 match 2 shared topics	Home \| Aya Aboulazm	en	marketing-and-advertising	robotsllmsaihumans	email phone	none
barnesvillefamilyhealthwellness.com ↗	64 match 2 shared topics	Marketing for Medical Practice \| Spark Medical Marketing	en	marketing-and-advertising WordPress WooCommerce	robotsllmsaihumans	emailphone	none
feedtheagency.com ↗	64 match 2 shared topics	Home - FEED. The Agency, Healthcare Marketing Agency	en	healthcare-industry WordPress WooCommerce	robotsllmsaihumans	emailphone	none
upexon.com ↗	64 match 2 shared topics	Healthcare Marketing Strategist for Doctors & Clinics \| Upexon	en	marketing-and-advertising WordPress	robotsllmsaihumans	email phone	none
carsdealpaystech.com ↗	64 match 2 shared topics	Target Patients MD - Medical Practice Growth Experts	en	marketing-and-advertising WordPress WooCommerce	robotsllmsaihumans	emailphone	none
carsdealerspaytechs.com ↗	64 match 2 shared topics	Target Patients MD - Medical Practice Growth Experts	en	marketing-and-advertising WordPress WooCommerce	robotsllmsaihumans	emailphone	none
carsdealerspaystechs.com ↗	64 match 2 shared topics	Target Patients MD - Medical Practice Growth Experts	en	marketing-and-advertising WordPress WooCommerce	robotsllmsaihumans	emailphone	none
carsdealer-paytech.com ↗	64 match 2 shared topics	Target Patients MD - Medical Practice Growth Experts	en	marketing-and-advertising WordPress WooCommerce	robotsllmsaihumans	emailphone	none
namastetuhealth.com ↗	64 match 2 shared topics	Healthcare Digital Marketing Agency \| Namastetu Health	en	marketing-and-advertising WordPress WooCommerce	robots llmsaihumans	email phone	none
2ndspark.com ↗	64 match 2 shared topics	Home \| 2nd Spark	en	healthcare-industry	robotsllmsaihumans	emailphone	none
federatehealth.com ↗	63 match 2 shared topics	Digital Marketing for Doctors \| Federate Health	en	marketing-and-advertising Wix	robots llmsaihumans	emailphone	none
luminusmedia.com ↗	63 match 2 shared topics	Healthcare Marketing Agency in Buffalo, NY ǀ Luminus Agency	en	marketing-and-advertising WordPress	robotsllmsaihumans	email phone	none
swiftstax.com ↗	63 match 2 shared topics	Home	en	healthcare-industry	robotsllmsaihumans	emailphone	none
digilogix.org ↗	63 match 2 shared topics	DigiLogix \| High-Impact Digital Marketing for Healthcare	en	marketing-and-advertising	robotsllmsaihumans	emailphone	none
jobyyoungseo.com ↗	63 match 2 shared topics	Joby Young SEO – Healthcare SEO Specialist \| Local Patient Growth	en	marketing-and-advertising	robotsllmsaihumans	emailphone	none
avily.com ↗	63 match 2 shared topics	Avily: The Industry Leaders in Healthcare Marketing	en	marketing-and-advertising	robotsllmsaihumans	email phone	none
3kangaroos.com ↗	63 match 2 shared topics	3KANGAROOS \| Healthcare Digital Marketing Agency	en	marketing-and-advertising WordPress WooCommerce	robotsllmsaihumans	emailphone	none

How the match score works

Each match is a 0–100 similarity score — the higher it is, the more two sites resemble one another. It’s computed automatically from our own crawl data (never from what a site says about itself) by combining several independent signals, so a high score means several of them point the same way:

shared topics how many of the same fine‑grained content topics (IAB sub‑categories) both sites cover — the main signal.
same category whether they sit in the same business / industry category.
content & title how closely their titles and page descriptions line up in wording and meaning.

No single signal decides the result — they’re blended together. Treat the score as a way to rank candidates rather than an absolute percentage; the chips on each result show which signals contributed.