| Domain | Match | Title | Country/Lang | Category | AI files | Contact | AI-protection |
|---|---|---|---|---|---|---|---|
| ajoyousevent.net ↗ | 70 match 1 shared topics |
A JOYOUS EVENT WEDDING OFFICIANT SERVICES - Home | en | weddingWeebly | robotsllmsaihumans | emailphone | none |
| chapeloftheflowers.com ↗ | 70 match 1 shared topics |
Chapel of The Flowers | Las Vegas Weddings | en | weddingHubSpot | robotsllmsaihumans | emailphone | none |
| easternshoreweddingvenues.com ↗ | 70 match 1 shared topics |
Ocean City MD Wedding Venue | All-Inclusive Beach Weddings | Barefoot Bride Weddings | United States~ en | weddingSquarespaceMagento | robotsllmsaihumans | emailphone | none |
| ahmweddings.com ↗ | 69 match 1 shared topics |
Expert Wedding Planning Services by ahm weddings | AHM Weddings | en | wedding | robotsllmsaihumans | emailphone | none |
| acaliforniawedding.com ↗ | 69 match 1 shared topics |
California Wedding DJ Services | Top Wedding DJ in California | DJ & Entertainment Packages | en | weddingWordPress | robotsllmsaihumans | emailphone | none |
| ronniewiseofficiant.com ↗ | 69 match 1 shared topics |
Ronnie Wise Serving Eastern NC Wedding Officiant :: Wedding Ceremonies Serving Eastern NC | en | wedding | robotsllmsaihumans | emailphone | none |
| abundantaloha.com ↗ | 69 match 1 shared topics |
Hawaii Wedding Officiant | en | wedding | robotsllmsaihumans | emailphone | none |
| baliweddingbutler.com ↗ | 69 match 1 shared topics |
Bali Wedding Organizer | Wedding Assistant in Bali - Wedding Packages | en | weddingWordPress | robotsllmsaihumans | emailphone | none |
| balifortwo.com ↗ | 69 match 1 shared topics |
Bali Wedding Planner & Wedding Packages | Bali For Two | en | weddingSquarespaceSquarespace Commerce | robotsllmsaihumans | emailphone | none |
| ablueridgewedding.com ↗ | 69 match 1 shared topics |
A Blue Ridge Wedding - Wedding Officiant | en | weddingWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| clarksvilleweddingsmadesimple.com ↗ | 69 match 1 shared topics |
Weddings Made Simple - Clarksville, TN Wedding Officiant | en | weddingSquarespaceMagento | robotsllmsaihumans | emailphone | none |
| mindfulceremony.com ↗ | 68 match 1 shared topics |
Bilingual Wedding Officiant DFW | en | wedding | robotsllmsaihumans | emailphone | none |
| yourmemorableday.com ↗ | 68 match 1 shared topics |
Your Memorable Day | Reno/Tahoe Wedding Ceremony Officiant | en | weddingWordPress | robotsllmsaihumans | emailphone | none |
| clareweddingdjs.com ↗ | 68 match 1 shared topics |
Wedding DJs, Photobooths & Wedding Packages in Clare | en | wedding | robotsllmsaihumans | emailphone | partial · 8 |
| cherishedmemoriesdj.com ↗ | 68 match 1 shared topics |
Book a Wedding DJ @ Cherished Memories Wedding DJ Services | en | weddingWix | robotsllmsaihumans | emailphone | none |
| foreverfilmz.com ↗ | 68 match 1 shared topics |
Forever Filmz | Wedding Videographer and Photographer | Cleveland Columbus Ohio Wedding Photo and Video Packages | en | weddingWix | robotsllmsaihumans | emailphone | none |
| 2theido.com ↗ | 68 match 1 shared topics |
Taking You Through To The "I Do" | Secular Wedding & Event Services | en | weddingWix | robotsllmsaihumans | emailphone | none |
| charlotteminister.com ↗ | 68 match 1 shared topics |
Charlotte Minister and Wedding Officiant - Charlotte Minister | en | weddingWeebly | robotsllmsaihumans | emailphone | none |