| Domain | Match | Title | Country/Lang | Category | AI files | Contact | AI-protection |
|---|---|---|---|---|---|---|---|
| luminarydata.org ↗ | 100 match 2 shared topics |
TouchPoint Media | Healthcare Marketing Agency for Medical Practices | en | healthcare-industry | robotsllmsaihumans | emailphone | none |
| 4healthcaremarketing.com ↗ | 75 match 2 shared topics |
4 Healthcare Marketing: Digital Marketing Agency for Private Practices | en | marketing-and-advertising | robotsllmsaihumans | emailphone | none |
| medicodigital.co.uk ↗ | 74 match 2 shared topics |
Healthcare Marketing Agency | MEDICO DIGITAL | GB en | marketing-and-advertising | robotsllmsaihumans | emailphone | none |
| 3kangaroos.com ↗ | 74 match 2 shared topics |
3KANGAROOS | Healthcare Digital Marketing Agency | en | marketing-and-advertisingWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| digitaldale.agency ↗ | 73 match 2 shared topics |
Digital Dale | Healthcare Marketing Agency | Scottsdale, AZ | en | marketing-and-advertisingWordPress | robotsllmsaihumans | emailphone | partial · 8 |
| sanesocialmedia.com ↗ | 73 match 2 shared topics |
Medical Digital Marketing | Healthcare Marketing That Delivers | en | marketing-and-advertisingWordPress | robotsllmsaihumans | emailphone | none |
| namastetuhealth.com ↗ | 73 match 2 shared topics |
Healthcare Digital Marketing Agency | Namastetu Health | en | marketing-and-advertisingWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| happimed.com ↗ | 72 match 2 shared topics |
Healthcare Digital Marketing Agency | HappiMed | en | marketing-and-advertisingWordPress | robotsllmsaihumans | emailphone | none |
| barnesvillefamilyhealthwellness.com ↗ | 72 match 2 shared topics |
Marketing for Medical Practice | Spark Medical Marketing | en | marketing-and-advertisingWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| feedtheagency.com ↗ | 72 match 2 shared topics |
Home - FEED. The Agency, Healthcare Marketing Agency | en | healthcare-industryWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| luminusmedia.com ↗ | 72 match 2 shared topics |
Healthcare Marketing Agency in Buffalo, NY ǀ Luminus Agency | en | marketing-and-advertisingWordPress | robotsllmsaihumans | emailphone | none |
| accelabrand.com ↗ | 71 match 2 shared topics |
Accelabrand | Leading Healthcare Marketing Agency | en | marketing-and-advertisingWordPress | robotsllmsaihumans | emailphone | none |
| usevitalspark.com ↗ | 71 match 2 shared topics |
Healthcare Marketing Agency | 100% HIPAA Compliant | Vital Spark | en | marketing-and-advertising | robotsllmsaihumans | emailphone | none |
| feelvitalspark.com ↗ | 71 match 2 shared topics |
Healthcare Marketing Agency | 100% HIPAA Compliant | Vital Spark | en | marketing-and-advertising | robotsllmsaihumans | emailphone | none |
| joinvitalspark.com ↗ | 71 match 2 shared topics |
Healthcare Marketing Agency | 100% HIPAA Compliant | Vital Spark | en | marketing-and-advertising | robotsllmsaihumans | emailphone | none |
| autumdigital.com ↗ | 71 match 2 shared topics |
Healthcare Digital Marketing Agency | Autum Digital | en | marketing-and-advertisingSanity | robotsllmsaihumans | emailphone | none |
| upexon.com ↗ | 70 match 2 shared topics |
Healthcare Marketing Strategist for Doctors & Clinics | Upexon | en | marketing-and-advertisingWordPress | robotsllmsaihumans | emailphone | none |
| zrqaa.com ↗ | 70 match 2 shared topics |
Zrqaa – Healthcare Marketing | en | marketing-and-advertisingWordPress | robotsllmsaihumans | emailphone | none |