similar sites

Browse

AI Report Tools

Sites similar to easyapplaud.org

Easyapplaud alternatives & similar sites

Review generation for medical & dental practices · applaud — 18 websites ranked by shared content topics, category and on-page relevance.

Each result shows its full tech stack, contacts and AI-policy — not just a name · Browse all sites in Healthcare Industry →

Domain	Match	Title	Country/Lang	Category	AI files	Contact	AI-protection
barnesvillefamilyhealthwellness.com ↗	70 match 2 shared topics	Marketing for Medical Practice \| Spark Medical Marketing	en	marketing-and-advertising WordPress WooCommerce	robotsllmsaihumans	emailphone	none
medical-rank.com ↗	69 match 2 shared topics	Local SEO Services for Healthcare Practitioners \| Medical Rank	United States~ en	marketing-and-advertising	robotsllmsaihumans	emailphone	none
mdappointtarget.com ↗	68 match 2 shared topics	Target Patients MD - Medical Practice Growth Experts	en	marketing-and-advertising WordPress WooCommerce	robotsllmsaihumans	emailphone	none
mdtargetedpatient.com ↗	68 match 2 shared topics	Target Patients MD - Medical Practice Growth Experts	en	marketing-and-advertising WordPress WooCommerce	robotsllmsaihumans	emailphone	none
dashlogin.com ↗	68 match 2 shared topics	MeasureMD — Healthcare Marketing Attribution for Surgical Practices	en	marketing-and-advertising	robotsllmsaihumans	emailphone	none
measuremd.com ↗	68 match 2 shared topics	MeasureMD — Healthcare Marketing Attribution for Surgical Practices	en	marketing-and-advertising	robotsllmsaihumans	emailphone	none
medamppro.com ↗	67 match 2 shared topics	AMP Medical - Digital Marketing Prowess for Medical Specialty and Surgical Practices	en	marketing-and-advertising WordPress	robotsllmsaihumans	emailphone	none
btoplocal.com ↗	67 match 2 shared topics	Be Top Local \| Patient Acquisition for Functional & Integrated Medical Clinics	en	marketing-and-advertising	robotsllmsaihumans	emailphone	none
mediciverxp.com ↗	67 match 2 shared topics	Healthcare Marketing Solutions for Medical Products and Services \| Med Rx Solution	en	healthcare-industry	robotsllmsaihumans	emailphone	none
vitalreachmedia.com ↗	67 match 2 shared topics	Vital Reach Media \| Premium Healthcare Lead Generation	en	healthcare-industry	robotsllmsaihumans	emailphone	none
oncallads.com ↗	66 match 2 shared topics	OnCall Ads \| Healthcare Patient Acquisition for DPC, Dental, Med-Spa & More	United States~ en	marketing-and-advertising	robotsllmsaihumans	emailphone	none
mediamd.com ↗	66 match 2 shared topics	MediaMD \| The Growth Engine for the Practices Patients Choose	en	marketing-and-advertising	robotsllmsaihumans	emailphone	none
medifren.com ↗	66 match 2 shared topics	Medifren Your Medical Office Friend \| Marketing & Comunication for clinics, private doctors offices	en	marketing-and-advertising WordPress WooCommerce	robotsllmsaihumans	emailphone	none
4healthcaremarketing.com ↗	66 match 2 shared topics	4 Healthcare Marketing: Digital Marketing Agency for Private Practices	en	marketing-and-advertising	robotsllmsaihumans	emailphone	none
medlaunchsolutions.com ↗	65 match 2 shared topics	Healthcare Medical Marketing \| Digital Marketing Services	en	marketing-and-advertising WordPress WooCommerce	robotsllmsaihumans	emailphone	none
medimktg.com ↗	65 match 2 shared topics	Medical Marketing \| Get More Patients	en	marketing-and-advertising WordPress WooCommerce	robots llmsaihumans	email phone	none
ddtest5.com ↗	64 match 2 shared topics	DPC Flow \| Marketing Automation For DPC Providers	en	marketing-and-advertising WordPress WooCommerce	robotsllmsaihumans	emailphone	none
mediamedcorp.com ↗	64 match 2 shared topics	MediaMed Corp \| Boutique Healthcare Marketing for Florida Medical Centers	en	marketing-and-advertising	robots llmsaihumans	emailphone	none

How the match score works

Each match is a 0–100 similarity score — the higher it is, the more two sites resemble one another. It’s computed automatically from our own crawl data (never from what a site says about itself) by combining several independent signals, so a high score means several of them point the same way:

shared topics how many of the same fine‑grained content topics (IAB sub‑categories) both sites cover — the main signal.
same category whether they sit in the same business / industry category.
content & title how closely their titles and page descriptions line up in wording and meaning.

No single signal decides the result — they’re blended together. Treat the score as a way to rank candidates rather than an absolute percentage; the chips on each result show which signals contributed.