| Domain | Match | Title | Country/Lang | Category | AI files | Contact | AI-protection |
|---|---|---|---|---|---|---|---|
| measuremd.com ↗ | 100 match 2 shared topics |
MeasureMD — Healthcare Marketing Attribution for Surgical Practices | en | marketing-and-advertising | robotsllmsaihumans | emailphone | none |
| 4healthcaremarketing.com ↗ | 73 match 2 shared topics |
4 Healthcare Marketing: Digital Marketing Agency for Private Practices | en | marketing-and-advertising | robotsllmsaihumans | emailphone | none |
| barnesvillefamilyhealthwellness.com ↗ | 71 match 2 shared topics |
Marketing for Medical Practice | Spark Medical Marketing | en | marketing-and-advertisingWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| bryancush.com ↗ | 71 match 2 shared topics |
Bryan Cush - Healthcare Marketing Leader | en | healthcare-industryWordPress | robotsllmsaihumans | emailphone | none |
| medicodigital.co.uk ↗ | 71 match 2 shared topics |
Healthcare Marketing Agency | MEDICO DIGITAL | United Kingdom en | marketing-and-advertising | robotsllmsaihumans | emailphone | none |
| fairo.ai ↗ | 70 match 2 shared topics |
Fairo - Healthcare Marketing for the Agent Era | en | marketing-and-advertising | robotsllmsaihumans | emailphone | none |
| onesourcemd.com ↗ | 70 match 2 shared topics |
One SourceMD - Marketing Services Agency for Healthcare | en | healthcare-industryWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| helvet-group.com ↗ | 70 match 2 shared topics |
Helvet Health - Healthcare marketing and communication agency | en | marketing-and-advertising | robotsllmsaihumans | emailphone | none |
| doceree.com ↗ | 70 match 2 shared topics |
Healthcare Marketing Platform for Pharma | Doceree | en | marketing-and-advertising | robotsllmsaihumans | emailphone | none |
| hellogetconnected.com ↗ | 70 match 2 shared topics |
Hello Get Connected | Healthcare Marketing Agency | en | marketing-and-advertising | robotsllmsaihumans | emailphone | none |
| 3kangaroos.com ↗ | 70 match 2 shared topics |
3KANGAROOS | Healthcare Digital Marketing Agency | en | marketing-and-advertisingWordPressWooCommerce | robotsllmsaihumans | emailphone | none |
| houstonshoulderclinic.com ↗ | 69 match 2 shared topics |
Digital Marketing Solutions for Healthcare Professionals| Healthcare Web Marketing | United States~ en | marketing-and-advertising | robotsllmsaihumans | emailphone | none |
| vitruviusscience.com ↗ | 69 match 2 shared topics |
RevHealth | Healthcare Marketing Agency Driving Brand Transformation | en | marketing-and-advertisingHubSpot | robotsllmsaihumans | emailphone | none |
| vitruvius-science.com ↗ | 69 match 2 shared topics |
RevHealth | Healthcare Marketing Agency Driving Brand Transformation | en | marketing-and-advertisingHubSpot | robotsllmsaihumans | emailphone | none |
| mazharshah.com ↗ | 69 match 2 shared topics |
Digital Marketing - Mazhar Shah | Healthcare Marketing Consultant | PK~ en | marketing-and-advertisingWordPress | robotsllmsaihumans | emailphone | none |
| kauferdmc.com ↗ | 69 match 2 shared topics |
KDMC Empowers Your Healthcare Marketing Journey | KDMC | United States~ en | marketing-and-advertisingWordPress | robotsllmsaihumans | emailphone | none |
| omnipremier.com ↗ | 69 match 2 shared topics |
OMNI Premier Marketing | Healthcare Digital Marketing Agency | en | marketing-and-advertisingWordPress | robotsllmsaihumans | emailphone | none |
| omnidentalmarketing.com ↗ | 69 match 2 shared topics |
OMNI Premier Marketing | Healthcare Digital Marketing Agency | en | marketing-and-advertisingWordPress | robotsllmsaihumans | emailphone | none |